Fatty acid desaturase 2 Antibody

Images

 
Immunohistochemistry-Paraffin: Fatty acid desaturase 2 Antibody [NBP1-84311] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Fatty acid desaturase 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMNLFKTNH
Specificity
Specificity of human Fatty acid desaturase 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FADS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Fatty acid desaturase 2 Protein (NBP1-84311PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Fatty acid desaturase 2 Antibody

  • D6DLLCDL2
  • Delta(6) desaturase
  • Delta(6) fatty acid desaturase
  • Delta-6 desaturase
  • delta-6 fatty acid desaturase
  • delta-6-desaturase
  • DES6
  • EC 1.14.19
  • EC 1.14.19.-
  • FADSD6
  • fatty acid desaturase 2
  • linoleoyl-CoA desaturase (delta-6-desaturase)-like 2
  • SLL0262
  • TU13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16407
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26393
Species: Hu
Applications: WB, ICC/IF
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western, IHC
NBP1-84752
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56713
Species: Hu
Applications: WB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-47863
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89796
Species: Hu, Mu
Applications: IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-33500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00054898-P01
Species: Hu
NBL1-11664
Species: Hu
NBP2-38958
Species: Hu
Applications: IHC, IHC-P
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP2-03523
Species: Hu, Ca
Applications: WB, Flow
NBP1-84311
Species: Hu
Applications: IHC, IHC-P

Publications for Fatty acid desaturase 2 Antibody (NBP1-84311) (0)

There are no publications for Fatty acid desaturase 2 Antibody (NBP1-84311).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fatty acid desaturase 2 Antibody (NBP1-84311) (0)

There are no reviews for Fatty acid desaturase 2 Antibody (NBP1-84311). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Fatty acid desaturase 2 Antibody (NBP1-84311) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Fatty acid desaturase 2 Antibody (NBP1-84311)

Discover related pathways, diseases and genes to Fatty acid desaturase 2 Antibody (NBP1-84311). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fatty acid desaturase 2 Antibody (NBP1-84311)

Discover more about diseases related to Fatty acid desaturase 2 Antibody (NBP1-84311).
 

Pathways for Fatty acid desaturase 2 Antibody (NBP1-84311)

View related products by pathway.

PTMs for Fatty acid desaturase 2 Antibody (NBP1-84311)

Learn more about PTMs related to Fatty acid desaturase 2 Antibody (NBP1-84311).

Blogs on Fatty acid desaturase 2

There are no specific blogs for Fatty acid desaturase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fatty acid desaturase 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FADS2