We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

FATP2/SLC27A2 Recombinant Protein Antigen

Images

 
There are currently no images for FATP2/SLC27A2 Recombinant Protein Antigen (NBP3-05516PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FATP2/SLC27A2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FATP2/SLC27A2.

Source: E. coli

Amino Acid Sequence: SLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIYYVSRTSNTDGIDSFLDKVDEVSTEPIPESWRSEVTFSTPALYIYTSGTTGLPKAAMITHQRIWYGTGLTFVSGLKADDVIYITLPFYHSAALLIGIHGCIVAGAT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC27A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-05516.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FATP2/SLC27A2 Recombinant Protein Antigen

  • ACSVL1
  • ACSVL1FATP-2
  • EC 6.2.1
  • EC 6.2.1.-
  • EC 6.2.1.3
  • EC 6.2.1.7
  • FACVL1
  • FACVL1very long-chain fatty-acid-coenzyme A ligase 1
  • FATP2
  • FATP2THCA-CoA ligase
  • Fatty acid transport protein 2
  • Fatty-acid-coenzyme A ligase, very long-chain 1
  • hFACVL1
  • HsT17226
  • Long-chain-fatty-acid--CoA ligase
  • SLC27A2
  • solute carrier family 27 (fatty acid transporter), member 2
  • Solute carrier family 27 member 2
  • THCA-CoA ligase
  • very-long-chain acyl-CoA synthetase
  • VLACS
  • VLACSVery long-chain-fatty-acid-CoA ligase
  • VLCS
  • VLCSvery long-chain acyl-CoA synthetase

Background

SLC27A2 is encoded by this gene is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46476
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, KO, WB
NBP3-05510
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB3304
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-81909
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP1-89267
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-89270
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02554
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP1-84565
Species: Hu
Applications: IHC,  IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-87258
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB400-144
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-89265
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP2-94796
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP3-47877
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP3-05516PEP
Species: Hu
Applications: AC

Publications for FATP2/SLC27A2 Recombinant Protein Antigen (NBP3-05516PEP) (0)

There are no publications for FATP2/SLC27A2 Recombinant Protein Antigen (NBP3-05516PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FATP2/SLC27A2 Recombinant Protein Antigen (NBP3-05516PEP) (0)

There are no reviews for FATP2/SLC27A2 Recombinant Protein Antigen (NBP3-05516PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FATP2/SLC27A2 Recombinant Protein Antigen (NBP3-05516PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FATP2/SLC27A2 Products

Blogs on FATP2/SLC27A2

There are no specific blogs for FATP2/SLC27A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FATP2/SLC27A2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC27A2