FASTKD2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: FASTKD2 Antibody [NBP2-57917] - Staining of human cell line U-2 OS shows localization to mitochondria & cytokinetic bridge.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FASTKD2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FASTKD2 Antibody - BSA Free (NBP2-57917) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QQVWKIEDVFTLQVVMKCIGKDAPIALKRKLEMKALRELDRFSVLNSQHMFEVLAAMNHRSLILLDECSKVVLDNIHGCPLRIMINILQSCKDLQY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FASTKD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FASTKD2 Recombinant Protein Antigen (NBP2-57917PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FASTKD2 Antibody - BSA Free

• FAST kinase domains 2
• KIAA0971FAST kinase domain-containing protein 2

Background

FASTKD2 codes for a protien with two isoforms, one that has a length of 710 amino acids and a mass of approximately 81 kDa, with a shorter isoform with a length of 648 amino acids and a weight of approximately 75 kDa, and both isoforms code for a protein that may play a role in mitochondrial apoptosis. Current studies have been done on diseases and disorders relating to this gene, including breast cancer. FASTKD2 has also been shown to have interactions with ICT1, MYC, PHLDA3, TRAF6, and TSC22D1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FASTKD2