FASTK Antibody


Western Blot: FASTK Antibody [NBP1-84729] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: FASTK Antibody [NBP1-84729] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Western Blot: FASTK Antibody [NBP1-84729] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-209

Product Details

Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

FASTK Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:GQAASSATTRDPAQRVVLVLRERWHFCRDGRVLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQKLQAL
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
FASTK Protein (NBP1-84729PEP)

Alternate Names for FASTK Antibody

  • EC
  • Fas-activated serine/threonine kinase
  • FASTFAST kinase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for FASTK Antibody (NBP1-84729) (0)

There are no publications for FASTK Antibody (NBP1-84729).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FASTK Antibody (NBP1-84729) (0)

There are no reviews for FASTK Antibody (NBP1-84729). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FASTK Antibody (NBP1-84729) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FASTK Antibody Products

Related Products by Gene

Bioinformatics Tool for FASTK Antibody (NBP1-84729)

Discover related pathways, diseases and genes to FASTK Antibody (NBP1-84729). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FASTK Antibody (NBP1-84729)

Discover more about diseases related to FASTK Antibody (NBP1-84729).

Pathways for FASTK Antibody (NBP1-84729)

View related products by pathway.

PTMs for FASTK Antibody (NBP1-84729)

Learn more about PTMs related to FASTK Antibody (NBP1-84729).

Research Areas for FASTK Antibody (NBP1-84729)

Find related products by research area.

Blogs on FASTK

There are no specific blogs for FASTK, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our FASTK Antibody and receive a gift card or discount.


Gene Symbol FASTK

Customers Who Bought This Also Bought