FASTK Antibody

Images

 
Western Blot: FASTK Antibody [NBP1-84729] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: FASTK Antibody [NBP1-84729] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Western Blot: FASTK Antibody [NBP1-84729] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4

Product Details

Summary
Reactivity Hu, Mu, Rt, Mouse, RatSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

FASTK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GQAASSATTRDPAQRVVLVLRERWHFCRDGRVLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQKLQAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FASTK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
FASTK Protein (NBP1-84729PEP)

Alternate Names for FASTK Antibody

  • EC 2.7.11.8
  • Fas-activated serine/threonine kinase
  • FASTFAST kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4248
Species: Hu
Applications: WB, ICC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46132
Species: Hu
Applications: WB, IHC
NB110-89726
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-31928
Species: Hu
Applications: IHC, IHC-P
NBP2-14344
Species: Hu
Applications: WB, IHC, IHC-P
H00009200-R01
Species: Hu
H00010487-B01P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-01819
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for FASTK Antibody (NBP1-84729) (0)

There are no publications for FASTK Antibody (NBP1-84729).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FASTK Antibody (NBP1-84729) (0)

There are no reviews for FASTK Antibody (NBP1-84729). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FASTK Antibody (NBP1-84729) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FASTK Antibody Products

Related Products by Gene

Bioinformatics Tool for FASTK Antibody (NBP1-84729)

Discover related pathways, diseases and genes to FASTK Antibody (NBP1-84729). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FASTK Antibody (NBP1-84729)

Discover more about diseases related to FASTK Antibody (NBP1-84729).
 

Pathways for FASTK Antibody (NBP1-84729)

View related products by pathway.

PTMs for FASTK Antibody (NBP1-84729)

Learn more about PTMs related to FASTK Antibody (NBP1-84729).
 

Research Areas for FASTK Antibody (NBP1-84729)

Find related products by research area.

Blogs on FASTK

There are no specific blogs for FASTK, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol FASTK

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-84729 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought