Recombinant Human Fast skeletal myosin light chain 1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Fast skeletal myosin light chain 1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 194 of Human MYL1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
MYL1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Fast skeletal myosin light chain 1 Protein

  • A1 catalytic
  • A2 catalytic
  • MLC1/MLC3
  • MLC1F
  • MLC1F/MLC3F
  • MLC3F
  • myosin light chain 1/3, skeletal muscle isoform
  • Myosin light chain A1/A2
  • Myosin light chain alkali 1/2
  • myosin, light chain 1, alkali; skeletal, fast
  • myosin, light polypeptide 1, alkali; skeletal, fast

Background

Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-88068
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-30954
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
MAB5018
Species: Hu
Applications: WB, IP
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF

Publications for Fast skeletal myosin light chain 1 Recombinant Protein (H00004632-P01) (0)

There are no publications for Fast skeletal myosin light chain 1 Recombinant Protein (H00004632-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fast skeletal myosin light chain 1 Recombinant Protein (H00004632-P01) (0)

There are no reviews for Fast skeletal myosin light chain 1 Recombinant Protein (H00004632-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fast skeletal myosin light chain 1 Recombinant Protein (H00004632-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Fast skeletal myosin light chain 1 Products

Bioinformatics Tool for Fast skeletal myosin light chain 1 Recombinant Protein (H00004632-P01)

Discover related pathways, diseases and genes to Fast skeletal myosin light chain 1 Recombinant Protein (H00004632-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fast skeletal myosin light chain 1 Recombinant Protein (H00004632-P01)

Discover more about diseases related to Fast skeletal myosin light chain 1 Recombinant Protein (H00004632-P01).
 

Pathways for Fast skeletal myosin light chain 1 Recombinant Protein (H00004632-P01)

View related products by pathway.

PTMs for Fast skeletal myosin light chain 1 Recombinant Protein (H00004632-P01)

Learn more about PTMs related to Fast skeletal myosin light chain 1 Recombinant Protein (H00004632-P01).
 

Research Areas for Fast skeletal myosin light chain 1 Recombinant Protein (H00004632-P01)

Find related products by research area.

Blogs on Fast skeletal myosin light chain 1

There are no specific blogs for Fast skeletal myosin light chain 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Fast skeletal myosin light chain 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MYL1