Fas/TNFRSF6/CD95 Antibody (3D7)

Images

 
Sandwich ELISA: Fas/TNFRSF6/CD95 Antibody (3D7) [H00000355-M08] - Detection limit for recombinant GST tagged FAS is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related Fas/TNFRSF6/CD95 Primary Antibodies

Order Details


    • Catalog Number
      H00000355-M08
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Fas/TNFRSF6/CD95 Antibody (3D7) Summary

Immunogen
FAS (NP_000034, 20 a.a. - 119 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINC
Specificity
FAS - Fas (TNF receptor superfamily, member 6) (3D7)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FAS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Fas/TNFRSF6/CD95 Antibody (3D7)

  • Apo-1 antigen
  • Apo-1
  • apoptosis antigen 1
  • Apoptosis-mediating surface antigen FAS
  • APT1
  • APT1FASTM
  • CD95 antigen
  • CD95
  • CD95ALPS1A
  • Fas (TNF receptor superfamily, member 6)
  • Fas AMA
  • Fas antigen
  • Fas
  • FAS1
  • FASLG receptor
  • TNFRSF6
  • TNFRSF6member 6
  • tumor necrosis factor receptor superfamily member 6

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. At least eight alternatively spliced transcript variants encoding seven distinct isoforms have been described. The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-77020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00000355-M08
Species: Hu
Applications: WB, ELISA

Publications for Fas/TNFRSF6/CD95 Antibody (H00000355-M08) (0)

There are no publications for Fas/TNFRSF6/CD95 Antibody (H00000355-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fas/TNFRSF6/CD95 Antibody (H00000355-M08) (0)

There are no reviews for Fas/TNFRSF6/CD95 Antibody (H00000355-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fas/TNFRSF6/CD95 Antibody (H00000355-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fas/TNFRSF6/CD95 Products

Bioinformatics Tool for Fas/TNFRSF6/CD95 Antibody (H00000355-M08)

Discover related pathways, diseases and genes to Fas/TNFRSF6/CD95 Antibody (H00000355-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fas/TNFRSF6/CD95 Antibody (H00000355-M08)

Discover more about diseases related to Fas/TNFRSF6/CD95 Antibody (H00000355-M08).
 

Pathways for Fas/TNFRSF6/CD95 Antibody (H00000355-M08)

View related products by pathway.

PTMs for Fas/TNFRSF6/CD95 Antibody (H00000355-M08)

Learn more about PTMs related to Fas/TNFRSF6/CD95 Antibody (H00000355-M08).
 

Research Areas for Fas/TNFRSF6/CD95 Antibody (H00000355-M08)

Find related products by research area.

Blogs on Fas/TNFRSF6/CD95

There are no specific blogs for Fas/TNFRSF6/CD95, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fas/TNFRSF6/CD95 Antibody (3D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol FAS
Entrez
Uniprot