FARP1 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human FARP1. Peptide sequence: CPRTDDEDEGRRKRFPTDKAYFIAKEVSTTERTYLKDLEVITSWFQSTVS The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FARP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for FARP1 Antibody - BSA Free
Background
FARP1 was originally isolated through subtractive hybridization due to its increased expression in differentiated chondrocytes versus dedifferentiated chondrocytes. The resulting protein contains a predicted ezrin-like domain, a Dbl homology domain, and a pleckstrin homology domain. It is believed to be a member of the band 4.1 superfamily whose members link the cytoskeleton to the cell membrane. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv(-), Ca(-), Ch(-), Hu, Mu(-), Rb(-)
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA, WB
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for FARP1 Antibody (NBP2-88815) (0)
There are no publications for FARP1 Antibody (NBP2-88815).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FARP1 Antibody (NBP2-88815) (0)
There are no reviews for FARP1 Antibody (NBP2-88815).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FARP1 Antibody (NBP2-88815) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FARP1 Products
Blogs on FARP1