FANCL Antibody

Images

 
Immunohistochemistry-Paraffin: FANCL Antibody [NBP1-84759] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FANCL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FPARAILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNIIFGECPYCSKPIT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FANCL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FANCL Protein (NBP1-84759PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FANCL Antibody

  • E3 ubiquitin-protein ligase FANCL
  • EC 6.3.2.-
  • FAAP43PHF9FLJ10335
  • Fanconi anemia group L protein
  • Fanconi anemia, complementation group L
  • Fanconi anemia-associated polypeptide of 43 kDa
  • PHD finger protein 9
  • Pog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2476
Species: Hu
Applications: IHC, WB
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
NB100-2564
Species: Hu
Applications: WB
NBP2-31993
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-31883
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PLA, WB
NBP1-18979
Species: Hu, Pm
Applications: Flow, ICC/IF, IP, WB
NBP2-52406
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
H00002189-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, KD, WB
H00002188-B01P
Species: Hu
Applications: ICC/IF, WB
NBP1-49878
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP2-50418
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-84608
Species: Hu
Applications: IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-02965
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-01109
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-84759
Species: Hu
Applications: IHC, IHC-P

Publications for FANCL Antibody (NBP1-84759) (0)

There are no publications for FANCL Antibody (NBP1-84759).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FANCL Antibody (NBP1-84759) (0)

There are no reviews for FANCL Antibody (NBP1-84759). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FANCL Antibody (NBP1-84759) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FANCL Products

Array NBP1-84759

Bioinformatics Tool for FANCL Antibody (NBP1-84759)

Discover related pathways, diseases and genes to FANCL Antibody (NBP1-84759). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FANCL Antibody (NBP1-84759)

Discover more about diseases related to FANCL Antibody (NBP1-84759).
 

Pathways for FANCL Antibody (NBP1-84759)

View related products by pathway.

PTMs for FANCL Antibody (NBP1-84759)

Learn more about PTMs related to FANCL Antibody (NBP1-84759).
 

Research Areas for FANCL Antibody (NBP1-84759)

Find related products by research area.

Blogs on FANCL.

Fanconi Antibodies and Cancer Research
We at Novus Biologicals have an extensive antibody databasedevoted to the 13 Fanconi anaemia complementation (FANC) genes, which are involved in the recognition and repair of damaged DNA.The core complex of 8 proteins (FANCA, B, C, E, F, G, L and M)...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FANCL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FANCL