Recombinant Human FANCI Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FANCI Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 73 of Human FLJ10719 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MFKDVPLTAEEVEFVVEKALSMFSKMNLQEIPPLVYQLLVLSSKGSRKSVLEGIIAFFSALDKQHNEEQSGDE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
FANCI

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FANCI Protein

  • Fanconi anemia group I protein
  • Fanconi anemia, complementation group I
  • KIAA1794FLJ10719
  • Protein FACI

Background

FLJ10719( AAH04277, 1 a.a. - 74 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
MAB2476
Species: Hu
Applications: WB, IHC
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP1-84758
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50418
Species: Hu
Applications: WB, ICC/IF, IP
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
21340002
Species: Hu
Applications: ELISA
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002189-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP1-18979
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IP
NBP1-42677
Species: Hu
Applications: WB, IHC-P, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC

Publications for FANCI Recombinant Protein (H00055215-P01) (0)

There are no publications for FANCI Recombinant Protein (H00055215-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FANCI Recombinant Protein (H00055215-P01) (0)

There are no reviews for FANCI Recombinant Protein (H00055215-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FANCI Recombinant Protein (H00055215-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FANCI Products

Bioinformatics Tool for FANCI Recombinant Protein (H00055215-P01)

Discover related pathways, diseases and genes to FANCI Recombinant Protein (H00055215-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FANCI Recombinant Protein (H00055215-P01)

Discover more about diseases related to FANCI Recombinant Protein (H00055215-P01).
 

Pathways for FANCI Recombinant Protein (H00055215-P01)

View related products by pathway.

PTMs for FANCI Recombinant Protein (H00055215-P01)

Learn more about PTMs related to FANCI Recombinant Protein (H00055215-P01).
 

Research Areas for FANCI Recombinant Protein (H00055215-P01)

Find related products by research area.

Blogs on FANCI.

FANCD2 and DNA damage repair
Fanconi anemia (FA) is a genetically inherited disorder that yields cytogenetic instability, hypersensitivity to DNA crosslinking compounds and defective DNA repair. A variety of genes have been identified within the FA pathway that are referred t...  Read full blog post.

Fanconi Antibodies and Cancer Research
We at Novus Biologicals have an extensive antibody databasedevoted to the 13 Fanconi anaemia complementation (FANC) genes, which are involved in the recognition and repair of damaged DNA.The core complex of 8 proteins (FANCA, B, C, E, F, G, L and M)...  Read full blog post.

Customers Who Bought This Also Bought

FANCD2 Antibody
NB100-182
FANCI Antibody
NB300-243

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FANCI Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FANCI