FANCI Recombinant Protein Antigen

Images

 
There are currently no images for FANCI Protein (NBP1-84608PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FANCI Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FANCI.

Source: E.coli

Amino Acid Sequence: YGKGVLSGEECKKQLINTLCSGRWDQQYVIQLTSMFKDVPLTAEEVEFVVEKALSMFSKMNLQEIPPLVYQLLVLSSKGSRKSVLEGIIAFFSALDKQHNEEQSGDELLDVVTVPSGE

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FANCI
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-84608.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for FANCI Recombinant Protein Antigen

  • Fanconi anemia group I protein
  • Fanconi anemia, complementation group I
  • KIAA1794FLJ10719
  • Protein FACI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
MAB2476
Species: Hu
Applications: WB, IHC
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NB100-308
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
NBP1-84758
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50418
Species: Hu
Applications: WB, ICC/IF, IHC-P, IP
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
21340002
Species: Hu
Applications: WB, ELISA
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-214
Species: Hu, Mu
Applications: WB, IP
NB100-2566
Species: Hu
Applications: WB
NBP1-18979
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IP
NBP1-42677
Species: Hu
Applications: WB, IHC-P, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC, KO

Publications for FANCI Protein (NBP1-84608PEP) (0)

There are no publications for FANCI Protein (NBP1-84608PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FANCI Protein (NBP1-84608PEP) (0)

There are no reviews for FANCI Protein (NBP1-84608PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for FANCI Protein (NBP1-84608PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for FANCI Protein (NBP1-84608PEP)

Discover related pathways, diseases and genes to FANCI Protein (NBP1-84608PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FANCI Protein (NBP1-84608PEP)

Discover more about diseases related to FANCI Protein (NBP1-84608PEP).
 

Pathways for FANCI Protein (NBP1-84608PEP)

View related products by pathway.

PTMs for FANCI Protein (NBP1-84608PEP)

Learn more about PTMs related to FANCI Protein (NBP1-84608PEP).
 

Research Areas for FANCI Protein (NBP1-84608PEP)

Find related products by research area.

Blogs on FANCI.

FANCD2 and DNA damage repair
Fanconi anemia (FA) is a genetically inherited disorder that yields cytogenetic instability, hypersensitivity to DNA crosslinking compounds and defective DNA repair. A variety of genes have been identified within the FA pathway that are referred t...  Read full blog post.

Fanconi Antibodies and Cancer Research
We at Novus Biologicals have an extensive antibody databasedevoted to the 13 Fanconi anaemia complementation (FANC) genes, which are involved in the recognition and repair of damaged DNA.The core complex of 8 proteins (FANCA, B, C, E, F, G, L and M)...  Read full blog post.

Customers Who Bought This Also Bought

FANCD2 Antibody
NB100-182
FANCI Antibody
NB100-60447

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FANCI Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FANCI