FAM82A Antibody

Images

 
Western Blot: FAM82A Antibody [NBP1-79509] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM82A Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human FAM82A. Peptide Sequence: WRFARAYGDMYELSTNTQEKKHYANIGKTLSERAINRAPMNGHCHLWYAV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RMDN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against FAM82A and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FAM82A Antibody

  • family with sequence similarity 82, member A1
  • member A
  • UNQ9371/PRO34163

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56655
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
NBP1-88089
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H6506-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-20204
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-18878
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-56700
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-16521
Species: Hu, Mu, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92354
Species: Hu
Applications: IHC, IHC-P
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-83875
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-79509
Species: Hu
Applications: WB

Publications for FAM82A Antibody (NBP1-79509) (0)

There are no publications for FAM82A Antibody (NBP1-79509).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM82A Antibody (NBP1-79509) (0)

There are no reviews for FAM82A Antibody (NBP1-79509). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM82A Antibody (NBP1-79509) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM82A Products

Bioinformatics Tool for FAM82A Antibody (NBP1-79509)

Discover related pathways, diseases and genes to FAM82A Antibody (NBP1-79509). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM82A

There are no specific blogs for FAM82A, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM82A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RMDN2
Uniprot
COVID-19 update