FAM3C Antibody

Images

 
Western Blot: FAM3C Antibody [NBP2-13996] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: FAM3C Antibody [NBP2-13996] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996] - Staining of human hippocampus shows strong granular cytoplasmic positivity in neurons.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM3C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEA RRLIADLGSTSITNLGFRDNWVFCG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM3C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
FAM3C Protein (NBP2-13996PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM3C Antibody

  • D6WSU176e
  • FAM3C
  • family with sequence similarity 3, member C
  • GS3876
  • ILEI
  • ILEIInterleukin-like EMT inducer
  • predicted osteoblast protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-46336
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF8064
Species: Hu
Applications: WB, IHC, ICC
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-14344
Species: Hu
Applications: WB, IHC, IHC-P
AF1334
Species: Hu
Applications: WB, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF23151
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FAM3C Antibody (NBP2-13996) (0)

There are no publications for FAM3C Antibody (NBP2-13996).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM3C Antibody (NBP2-13996) (0)

There are no reviews for FAM3C Antibody (NBP2-13996). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM3C Antibody (NBP2-13996) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM3C Products

Bioinformatics Tool for FAM3C Antibody (NBP2-13996)

Discover related pathways, diseases and genes to FAM3C Antibody (NBP2-13996). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM3C Antibody (NBP2-13996)

Discover more about diseases related to FAM3C Antibody (NBP2-13996).
 

Pathways for FAM3C Antibody (NBP2-13996)

View related products by pathway.

PTMs for FAM3C Antibody (NBP2-13996)

Learn more about PTMs related to FAM3C Antibody (NBP2-13996).

Blogs on FAM3C

There are no specific blogs for FAM3C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM3C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM3C
Entrez