FAM3C Antibody


Western Blot: FAM3C Antibody [NBP2-13996] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: FAM3C Antibody [NBP2-13996] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Orthogonal Strategies: Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996] - Staining in human duodenum and skeletal muscle tissues.. Corresponding FAM3C RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996] - Staining of human hippocampus shows strong granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996] - Staining in human duodenum and skeletal muscle tissues using anti-FAM3C antibody. Corresponding FAM3C RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996] - Staining of human cerebral cortex shows positivity in neurons.
Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996] - Staining of human placenta shows positivity in trophoblastic cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

FAM3C Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEA RRLIADLGSTSITNLGFRDNWVFCG
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
FAM3C Protein (NBP2-13996PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FAM3C Antibody

  • D6WSU176e
  • FAM3C
  • family with sequence similarity 3, member C
  • GS3876
  • ILEI
  • ILEIInterleukin-like EMT inducer
  • predicted osteoblast protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC

Publications for FAM3C Antibody (NBP2-13996) (0)

There are no publications for FAM3C Antibody (NBP2-13996).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM3C Antibody (NBP2-13996) (0)

There are no reviews for FAM3C Antibody (NBP2-13996). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM3C Antibody (NBP2-13996) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FAM3C Products

Bioinformatics Tool for FAM3C Antibody (NBP2-13996)

Discover related pathways, diseases and genes to FAM3C Antibody (NBP2-13996). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM3C Antibody (NBP2-13996)

Discover more about diseases related to FAM3C Antibody (NBP2-13996).

Pathways for FAM3C Antibody (NBP2-13996)

View related products by pathway.

PTMs for FAM3C Antibody (NBP2-13996)

Learn more about PTMs related to FAM3C Antibody (NBP2-13996).

Blogs on FAM3C

There are no specific blogs for FAM3C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM3C Antibody and receive a gift card or discount.


Gene Symbol FAM3C