FAM3C Antibody


Immunocytochemistry/ Immunofluorescence: FAM3C Antibody [NBP2-13995] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13995] - Staining of human duodenum shows positivity in glandular cells.
Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13995] - Staining of human hippocampus shows strong granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13995] - Staining of human cerebral cortex shows positivity in neurons.
Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13995] - Staining of human placenta shows positivity in trophoblastic cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

FAM3C Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANV V
Specificity of human FAM3C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
FAM3C Protein (NBP2-13995PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FAM3C Antibody

  • D6WSU176e
  • FAM3C
  • family with sequence similarity 3, member C
  • GS3876
  • ILEI
  • ILEIInterleukin-like EMT inducer
  • predicted osteoblast protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FAM3C Antibody (NBP2-13995) (0)

There are no publications for FAM3C Antibody (NBP2-13995).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM3C Antibody (NBP2-13995) (0)

There are no reviews for FAM3C Antibody (NBP2-13995). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM3C Antibody (NBP2-13995) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FAM3C Products

Bioinformatics Tool for FAM3C Antibody (NBP2-13995)

Discover related pathways, diseases and genes to FAM3C Antibody (NBP2-13995). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM3C Antibody (NBP2-13995)

Discover more about diseases related to FAM3C Antibody (NBP2-13995).

Pathways for FAM3C Antibody (NBP2-13995)

View related products by pathway.

PTMs for FAM3C Antibody (NBP2-13995)

Learn more about PTMs related to FAM3C Antibody (NBP2-13995).

Blogs on FAM3C

There are no specific blogs for FAM3C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM3C Antibody and receive a gift card or discount.


Gene Symbol FAM3C