FAM134B Antibody

Images

 
Western Blot: FAM134B Antibody [NBP1-59817] - 1: HEK293T 2: HEK293T mouse FAM134B over-expression, 1 ug 3: HEK293T mouse FAM134B over-expression, 4 ug 4: HEK293T human FAM134B over-expression, 1 ug 5: HEK293T human ...read more
Immunohistochemistry-Paraffin: FAM134B Antibody [NBP1-59817] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.
Western Blot: FAM134B Antibody [NBP1-59817] - Jurkat cell lysate, Antibody Titration: 0.625ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM134B Antibody Summary

Immunogen
Synthetic peptides corresponding to FAM134B The peptide sequence was selected from the middle region of FAM134B. Peptide sequence LSVSDTDVSEVSWTDNGTFNLSEGYTPQTDTSDDLDRPSEEVFSRDLSDF. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (100%), Canine (100%), Equine (100%), Rabbit (100%), Bovine (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM134B
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against FAM134B and was validated on Western Blot and immunohistochemistry-paraffin
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 5
using
NBP1-59817 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FAM134B Antibody

  • FAM134B protein
  • family with sequence similarity 134, member B
  • FLJ20152
  • FLJ22155
  • FLJ22179
  • HSAN2B
  • JK1

Background

The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65887
Species: Hu
Applications: Flow, IP
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-59643
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-60115
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1501
Species: Hu
Applications: WB, PEP-ELISA
NBP2-13967
Species: Hu
Applications: WB, IHC, IHC-P
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-84247
Species: Hu
Applications: WB
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-19098
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NB7276
Species: Ch
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
640-A3
Species: Mu
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-93356
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1798
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, GS

Publications for FAM134B Antibody (NBP1-59817) (0)

There are no publications for FAM134B Antibody (NBP1-59817).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for FAM134B Antibody (NBP1-59817) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human and Mouse.

Reviews using NBP1-59817:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human and Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot FAM134B NBP1-59817
Enlarge
5
reviewed by:
Anonymous
WB Human and Mouse 05/12/2017
View

Summary

ApplicationWestern Blot
Sample TestedHEK 293 cell lysate
SpeciesHuman and Mouse
LotQC14597-42390

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM134B Antibody (NBP1-59817) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM134B Products

Bioinformatics Tool for FAM134B Antibody (NBP1-59817)

Discover related pathways, diseases and genes to FAM134B Antibody (NBP1-59817). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM134B Antibody (NBP1-59817)

Discover more about diseases related to FAM134B Antibody (NBP1-59817).
 

Pathways for FAM134B Antibody (NBP1-59817)

View related products by pathway.

Blogs on FAM134B

There are no specific blogs for FAM134B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
05/12/2017
Application: WB
Species: Human and Mouse

Bioinformatics

Gene Symbol FAM134B
Uniprot