FAM134B Antibody - BSA Free

Western Blot: FAM134B Antibody [NBP1-59817] - 1: HEK293T 2: HEK293T mouse FAM134B over-expression, 1 ug 3: HEK293T mouse FAM134B over-expression, 4 ug 4: HEK293T human FAM134B over-expression, 1 ug 5: HEK293T human FAM134B over-expression, 4 ug. This image was submitted via customer Review.

Immunohistochemistry-Paraffin: FAM134B Antibody [NBP1-59817] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.

Western Blot: FAM134B Antibody [NBP1-59817] - Jurkat cell lysate, Antibody Titration: 0.625ug/ml

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

FAM134B Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to FAM134B The peptide sequence was selected from the middle region of FAM134B. Peptide sequence LSVSDTDVSEVSWTDNGTFNLSEGYTPQTDTSDDLDRPSEEVFSRDLSDF. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RETREG1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 39 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for FAM134B Antibody - BSA Free

• FAM134B protein
• family with sequence similarity 134, member B
• FLJ20152
• FLJ22155
• FLJ22179
• HSAN2B
• JK1

Background

The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for FAM134B Antibody (NBP1-59817) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human and Mouse.

reviewed by: Verified Customer WB Human and Mouse 05/12/2017

Summary

• Application: Western Blot
• Sample Tested: HEK 293 cell lysate
• Species: Human and Mouse
• Lot: QC14597-42390

Bioinformatics

• Gene Symbol: RETREG1
• Uniprot:
  • Q9H6L5-2(Human)