FAM107A Antibody - BSA Free

Western Blot: FAM107A Antibody [NBP1-54335] - Transfected 293T cell lysate, concentration 0.0625ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

FAM107A Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to FAM107A(family with sequence similarity 107, member A) The peptide sequence was selected from the middle region of FAM107A. Peptide sequence RLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAM107A
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 17 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for FAM107A Antibody - BSA Free

• downregulated in renal cell carcinoma
• DRR1family with sequence similarity 107 member A transcript
• family with sequence similarity 107, member A
• FLJ30158
• FLJ45473
• Protein TU3A
• TU3ADown-regulated in renal cell carcinoma 1

Background

When FAM107A is transfected into cell lines in which it is not expressed, it suppresses cell growth. It may play a role in tumor development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM107A Antibody (NBP1-54335)(2)

Publications using NBP1-54335

• Luo M, Li Y, Peng B et al. A Multifunctional Porous Silicon Nanocarrier for Glioblastoma Treatment Molecular pharmaceutics 2023-01-02 [PMID: 36484477]
• Wang D, Feng M, Ma X et al. Transcription factor SP1-induced microRNA-146b-3p facilitates the progression and metastasis of colorectal cancer via regulating FAM107A Life sciences 2021-04-05 [PMID: 33831429]

Bioinformatics

• Gene Symbol: FAM107A
• Uniprot:
  • O95990(Human)