Recombinant Human FAIM2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FAIM2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-316 of Human FAIM2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE

Protein/Peptide Type
Recombinant Protein
Gene
FAIM2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00023017-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
PBS, 50% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FAIM2 Protein

  • Fas apoptotic inhibitory molecule 2
  • KIAA0950NGP35
  • LFG2
  • LFGLIFEGUARD
  • NMP35neural membrane protein 35
  • Protein lifeguard
  • TMBIM2lifeguard
  • transmembrane BAX inhibitor motif containing 2
  • Transmembrane BAX inhibitor motif-containing protein 2

Background

FAIM2( AAH00051, 1 a.a. - 317 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-60935
Species: Hu, Mu, Pm
Applications: WB
NBP1-76997
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF5394
Species: Hu, Mu
Applications: WB
NBP1-90558
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IF
NBP1-92093
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14148
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76998
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF6915
Species: Hu, Mu, Rt
Applications: WB
NBP2-14950
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-24912
Species: Hu, Mu, Rt
Applications: WB, IHC-P
AF5634
Species: Hu
Applications: WB
H00023017-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for FAIM2 Recombinant Protein (H00023017-P01)(1)

Reviews for FAIM2 Recombinant Protein (H00023017-P01) (0)

There are no reviews for FAIM2 Recombinant Protein (H00023017-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAIM2 Recombinant Protein (H00023017-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FAIM2 Products

Bioinformatics Tool for FAIM2 Recombinant Protein (H00023017-P01)

Discover related pathways, diseases and genes to FAIM2 Recombinant Protein (H00023017-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAIM2 Recombinant Protein (H00023017-P01)

Discover more about diseases related to FAIM2 Recombinant Protein (H00023017-P01).
 

Pathways for FAIM2 Recombinant Protein (H00023017-P01)

View related products by pathway.

PTMs for FAIM2 Recombinant Protein (H00023017-P01)

Learn more about PTMs related to FAIM2 Recombinant Protein (H00023017-P01).
 

Research Areas for FAIM2 Recombinant Protein (H00023017-P01)

Find related products by research area.

Blogs on FAIM2

There are no specific blogs for FAIM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF
FAIM2 Antibody
NBP2-24713

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FAIM2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FAIM2