F box protein 38 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DEENDFRQDLQPGEQQFAADALNEMEDIVQEDGEVVAESGNNTPAHSQAIIPVDVDEEQAGPSGLQRVVKPTSITVHDSESDDEEDSLELQEVWIPKN |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FBXO38 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for F box protein 38 Antibody - BSA Free
Background
Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination anddegradation. May coactivate KLF7, but does not seem to promote KLF7 ubiquitination
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, ICFlow, Neut, WB
Species: Hu
Applications: ICC
Species: Mu
Applications: IHC, WB
Species: Mu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF
Publications for F box protein 38 Antibody (NBP2-58958) (0)
There are no publications for F box protein 38 Antibody (NBP2-58958).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for F box protein 38 Antibody (NBP2-58958) (0)
There are no reviews for F box protein 38 Antibody (NBP2-58958).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for F box protein 38 Antibody (NBP2-58958) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional F box protein 38 Products
Research Areas for F box protein 38 Antibody (NBP2-58958)
Find related products by research area.
|
Blogs on F box protein 38