EZH1 Recombinant Protein Antigen

Images

 
There are currently no images for EZH1 Recombinant Protein Antigen (NBP2-69048PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

EZH1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EZH1.

Source: E. coli

Amino Acid Sequence: YKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGRRRRRHHIVSASCSNASASAVAETKEGDSDRDTGNDWASSSSE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EZH1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-69048.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EZH1 Recombinant Protein Antigen

  • EC 2.1.1.356
  • EC 2.1.1.43
  • enhancer of zeste homolog 1 (Drosophila)
  • Enhancer of zeste homolog 1
  • ENX-2
  • EZH1
  • histone-lysine N-methyltransferase EZH1
  • KIAA0388
  • KIAA0388enhancer of zeste (Drosophila) homolog 1
  • KMT6B

Background

EZH1 is a human homolog of the Drosophila gene Enhancer of zeste E(z), a member of the polycomb group of transcriptional repressors. In mice, EZH1 is a regulator of homeotic gene expression implicated in the assembly of repressive protein complexes in chromatin. The strong sequence conservation between species suggests potential role for EZH1 in human development as a transcriptional regulator and as a component of protein complexes that stably maintain heterochromatin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4767
Species: Hu, Mu
Applications: ICC, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
AF5827
Species: Hu, Mu
Applications: WB
MAB4184
Species: Hu, Mu
Applications: ICC, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP1-06640
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, WB
NBP3-13283
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-00588
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF3709
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-43299
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF4654
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-80959
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-03891
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-69048PEP
Species: Hu
Applications: AC

Publications for EZH1 Recombinant Protein Antigen (NBP2-69048PEP) (0)

There are no publications for EZH1 Recombinant Protein Antigen (NBP2-69048PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EZH1 Recombinant Protein Antigen (NBP2-69048PEP) (0)

There are no reviews for EZH1 Recombinant Protein Antigen (NBP2-69048PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EZH1 Recombinant Protein Antigen (NBP2-69048PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EZH1 Products

Research Areas for EZH1 Recombinant Protein Antigen (NBP2-69048PEP)

Find related products by research area.

Blogs on EZH1.

EZH1 has more to offer than gene repression
EZH1 is part of the Polycomb-group family of proteins, which are responsible for remodeling chromatin in genes and modulating epigenetic silencing during development.  Specifically, EZHI is a component of PRC2, or polycomb repressive complex-2.  PR...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EZH1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EZH1