Exportin-5 Antibody

Images

 
Western Blot: Exportin-5 Antibody [NBP1-89607] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: Exportin-5 Antibody [NBP1-89607] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Exportin-5 Antibody [NBP1-89607] - Staining of human tonsil shows strong cytoplasmic positivity in subsets of cells outside the germinal center.
Western Blot: Exportin-5 Antibody [NBP1-89607] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-195

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Exportin-5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MSFCVYSILGVVKRTCWPTDLEEAKAGGFVVGYTSSGNPIFRNPCTEQILKLLDNLLALIRTHNTLYAPEMLAKMAEPFTKALDMLDAEKSAILGLPQPLLELNDSPVFKTVLERMQRFFSTLYENC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
XPO5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Immunofluorescence
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Exportin-5 Protein (NBP1-89607PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Exportin-5 Antibody

  • Exp5
  • exportin 5
  • exportin-5
  • FLJ14239
  • FLJ32057
  • FLJ45606
  • KIAA1291exp5
  • Ran-binding protein 21
  • RANBP21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06520
Species: Hu, Mu
Applications: WB, IP
NBP1-03349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-57176
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-24725
Species: Hu, Eq, Pm
Applications: WB, IHC-P
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-84056
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2817
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-88667
Species: Hu
Applications: IHC, IHC-P
NBP1-31113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38572
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008894-M09
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for Exportin-5 Antibody (NBP1-89607) (0)

There are no publications for Exportin-5 Antibody (NBP1-89607).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Exportin-5 Antibody (NBP1-89607) (0)

There are no reviews for Exportin-5 Antibody (NBP1-89607). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Exportin-5 Antibody (NBP1-89607) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Exportin-5 Products

Bioinformatics Tool for Exportin-5 Antibody (NBP1-89607)

Discover related pathways, diseases and genes to Exportin-5 Antibody (NBP1-89607). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Exportin-5 Antibody (NBP1-89607)

Discover more about diseases related to Exportin-5 Antibody (NBP1-89607).
 

Pathways for Exportin-5 Antibody (NBP1-89607)

View related products by pathway.

PTMs for Exportin-5 Antibody (NBP1-89607)

Learn more about PTMs related to Exportin-5 Antibody (NBP1-89607).
 

Research Areas for Exportin-5 Antibody (NBP1-89607)

Find related products by research area.

Blogs on Exportin-5

There are no specific blogs for Exportin-5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Exportin-5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol XPO5