Exportin-5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Exportin-5 Antibody [NBP1-89605] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

Analysis in human testis and liver tissues using Anti-XPO5 antibody. Corresponding XPO5 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Exportin-5 Antibody [NBP1-89605] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: Exportin-5 Antibody [NBP1-89605] - Staining of human liver shows low expression as expected.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Western Blot: Exportin-5 Antibody [NBP1-89605] - Analysis using Anti-XPO5 antibody NBP1-89605 (A) shows similar pattern to independent antibody NBP1-89606 (B).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Exportin-5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ASLVHLAFQIYEALRPRYLEIRAVMEQIPEIQKDSLDQFDCKLLNPSLQKVADKRRKDQFKRLIAGCIGKPLGEQFRKEVH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: XPO5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Exportin-5 Protein (NBP1-89605PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Exportin-5 Antibody - BSA Free

• Exp5
• exportin 5
• exportin-5
• FLJ14239
• FLJ32057
• FLJ45606
• KIAA1291exp5
• Ran-binding protein 21
• RANBP21

Background

Exportin-5 belongs to a large family of karyopherins (see MIM 602738) that mediate the transport of proteins and other cargo between the nuclear and cytoplasmic compartments.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: XPO5