Exosome component 7 Antibody (6E5N8) Summary
| Description |
Novus Biologicals Rabbit Exosome component 7 Antibody (6E5N8) (NBP3-15270) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Exosome component 7 (Q15024). MASVTLSEAEKVYIVHGVQEDLRVDGRGCEDYRCVEVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDCSASATPEFEGRGGDD |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
EXOSC7 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Exosome component 7 Antibody (6E5N8)
Background
Exosome component 7 is a component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3'-untranslated regions. Required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA. H
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Ch, Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Publications for Exosome component 7 Antibody (NBP3-15270) (0)
There are no publications for Exosome component 7 Antibody (NBP3-15270).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Exosome component 7 Antibody (NBP3-15270) (0)
There are no reviews for Exosome component 7 Antibody (NBP3-15270).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Exosome component 7 Antibody (NBP3-15270) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Exosome component 7 Products
Research Areas for Exosome component 7 Antibody (NBP3-15270)
Find related products by research area.
|
Blogs on Exosome component 7