Exosome component 5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Exosome component 5 Antibody [NBP2-56887] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Exosome component 5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MEEETHTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEI
Specificity
Specificity of human Exosome component 5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EXOSC5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Exosome component 5 Recombinant Protein Antigen (NBP2-56887PEP)

Reactivity Notes

Mouse 80%, Rat 81%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Exosome component 5 Antibody

  • CML28
  • exosome complex exonuclease RRP46
  • exosome component 5Chronic myelogenous leukemia tumor antigen 28
  • exosome component Rrp46
  • hRrp46p
  • MGC12901
  • p12BMGC111224
  • RRP41B
  • Rrp46p
  • RRP46Ribosomal RNA-processing protein 46

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82170
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-04611
Species: Hu
NBP1-85539
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20235
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45545
Species: Hu
Applications: WB, IHC
NBP1-91874
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5129
Species: Hu
Applications: WB
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-84621
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25255
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-20940
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56637
Species: Hu, Mu
Applications: WB
NBP2-67203
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86615
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-75597
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-01732
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-56887
Species: Hu
Applications: ICC/IF

Publications for Exosome component 5 Antibody (NBP2-56887) (0)

There are no publications for Exosome component 5 Antibody (NBP2-56887).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Exosome component 5 Antibody (NBP2-56887) (0)

There are no reviews for Exosome component 5 Antibody (NBP2-56887). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Exosome component 5 Antibody (NBP2-56887) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Exosome component 5 Products

Bioinformatics Tool for Exosome component 5 Antibody (NBP2-56887)

Discover related pathways, diseases and genes to Exosome component 5 Antibody (NBP2-56887). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Exosome component 5 Antibody (NBP2-56887)

Discover more about diseases related to Exosome component 5 Antibody (NBP2-56887).
 

Pathways for Exosome component 5 Antibody (NBP2-56887)

View related products by pathway.

PTMs for Exosome component 5 Antibody (NBP2-56887)

Learn more about PTMs related to Exosome component 5 Antibody (NBP2-56887).

Blogs on Exosome component 5

There are no specific blogs for Exosome component 5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Exosome component 5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EXOSC5