Exosome component 1 Antibody

Images

 
Western Blot: Exosome component 1 Antibody [NBP1-84523] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Exosome component 1 Antibody [NBP1-84523] - Staining of human vulva/anal skin shows strong nucleolar positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Exosome component 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:APPVRYCIPGERLCNLEEGSPGSGTYTRHGYIFSSLAGCLMKSSENGALPVVSVVRETESQLLPDVGAIVTCKVSSINSRFAKVHILYVGSMPLKNS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EXOSC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Exosome component 1 Protein (NBP1-84523PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Exosome component 1 Antibody

  • CGI-108,3'-5' exoribonuclease CSL4 homolog
  • CSL4 exosomal core protein homolog
  • Csl4p
  • CSL4p13
  • exosomal core protein CSL4
  • exosome component 1hCsl4p
  • homolog of yeast exosomal core protein CSL4
  • SKI4
  • Ski4p

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00027130-P02
Species: Hu
NB600-248
Species: Hu
Applications: WB, IP
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
AF7250
Species: Hu
Applications: IHC
MAB6798
Species: Hu
Applications: WB, ICC
MAB7650
Species: Mu
Applications: WB, IHC
NBP2-49672
Species: Hu
Applications: IHC
H00057804-M01A
Species: Hu
Applications: WB, ELISA
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Exosome component 1 Antibody (NBP1-84523) (0)

There are no publications for Exosome component 1 Antibody (NBP1-84523).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Exosome component 1 Antibody (NBP1-84523) (0)

There are no reviews for Exosome component 1 Antibody (NBP1-84523). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Exosome component 1 Antibody (NBP1-84523) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Exosome component 1 Products

Bioinformatics Tool for Exosome component 1 Antibody (NBP1-84523)

Discover related pathways, diseases and genes to Exosome component 1 Antibody (NBP1-84523). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Exosome component 1 Antibody (NBP1-84523)

Discover more about diseases related to Exosome component 1 Antibody (NBP1-84523).
 

Pathways for Exosome component 1 Antibody (NBP1-84523)

View related products by pathway.

Research Areas for Exosome component 1 Antibody (NBP1-84523)

Find related products by research area.

Blogs on Exosome component 1

There are no specific blogs for Exosome component 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Exosome component 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EXOSC1