Evx1 Antibody

Images

 
Western Blot: Evx1 Antibody [NBP1-79702] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Evx1 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human EVX1The immunogen for this antibody is EVX1. Peptide sequence GSGSEALVGSPNGGSETPKSNGGSGGGGSQGTLACSASDQMRRYRTAFTR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EVX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against EVX1 and was validated on Western blot.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Evx1 Antibody

  • eve, even-skipped homeo box homolog 1
  • eve, even-skipped homeobox homolog 1 (Drosophila)
  • eve, even-skipped homeobox homolog 1
  • even-skipped homeo box 1 (homolog of Drosophila)
  • even-skipped homeobox 1
  • EVX-1
  • homeobox even-skipped homolog protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90973
Species: Hu
Applications: ICC/IF, IHC, IHC-P
423-F8/CF
Species: Hu, Mu
NBP2-46076
Species: Hu
Applications: WB, IHC
H00002019-M04
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-47790
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-58808
Species: Hu
Applications: WB, ICC/IF
H00028299-P01
Species: Hu
AF2400
Species: Hu
Applications: WB, ChIP, ICC
H00005076-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00008022-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
AF5014
Species: Hu
Applications: WB, ICC
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
645-WN/CF
Species: Hu, Mu
NBP1-90978
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-79702
Species: Hu
Applications: WB

Publications for Evx1 Antibody (NBP1-79702) (0)

There are no publications for Evx1 Antibody (NBP1-79702).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Evx1 Antibody (NBP1-79702) (0)

There are no reviews for Evx1 Antibody (NBP1-79702). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Evx1 Antibody (NBP1-79702) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Evx1 Products

Bioinformatics Tool for Evx1 Antibody (NBP1-79702)

Discover related pathways, diseases and genes to Evx1 Antibody (NBP1-79702). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Evx1 Antibody (NBP1-79702)

Discover more about diseases related to Evx1 Antibody (NBP1-79702).
 

Pathways for Evx1 Antibody (NBP1-79702)

View related products by pathway.

PTMs for Evx1 Antibody (NBP1-79702)

Learn more about PTMs related to Evx1 Antibody (NBP1-79702).

Blogs on Evx1

There are no specific blogs for Evx1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Evx1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EVX1
Uniprot