EVA1/MPZL2 Antibody

Images

 
Immunohistochemistry-Paraffin: EVA1/MPZL2 Antibody [NBP2-31836] - Staining of human esophagus shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry: MPZL2 Antibody [NBP2-31836] - Staining of human pancreas shows moderate, granular cytoplasmic positivity in exocrine glandular cells and islets of Langerhans.
Immunohistochemistry: MPZL2 Antibody [NBP2-31836] - Staining of liver.
Immunohistochemistry: MPZL2 Antibody [NBP2-31836] - Staining of liver cancer.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EVA1/MPZL2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VLFQHYRKKRWAERAHKVVEIKSKEEERLNQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPZL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EVA1/MPZL2 Protein (NBP2-31836PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EVA1/MPZL2 Antibody

  • EVA1
  • EVAEpithelial V-like antigen 1EVA1myelin protein zero-like protein 2
  • MPZL2
  • myelin protein zero-like 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-79280
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-76959
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-88617
Species: Hu
Applications: IHC, IHC-P
NBP1-54903
Species: Hu
Applications: WB
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45867
Species: Hu
Applications: WB, Flow, IHC
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12547
Species: Hu
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31836
Species: Hu
Applications: IHC, IHC-P

Publications for EVA1/MPZL2 Antibody (NBP2-31836) (0)

There are no publications for EVA1/MPZL2 Antibody (NBP2-31836).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EVA1/MPZL2 Antibody (NBP2-31836) (0)

There are no reviews for EVA1/MPZL2 Antibody (NBP2-31836). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EVA1/MPZL2 Antibody (NBP2-31836) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EVA1/MPZL2 Products

Bioinformatics Tool for EVA1/MPZL2 Antibody (NBP2-31836)

Discover related pathways, diseases and genes to EVA1/MPZL2 Antibody (NBP2-31836). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EVA1/MPZL2 Antibody (NBP2-31836)

Discover more about diseases related to EVA1/MPZL2 Antibody (NBP2-31836).
 

Pathways for EVA1/MPZL2 Antibody (NBP2-31836)

View related products by pathway.

Blogs on EVA1/MPZL2

There are no specific blogs for EVA1/MPZL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EVA1/MPZL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MPZL2
Entrez
Uniprot