Recombinant Human ETFDH Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ETFDH Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human ETFDH partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LLSSVALSGTNHEHDQPAHLTLRDDSIPVNRNLSIYDGPEQRFCPAGVYEFVPVEQGDGFRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM

Protein/Peptide Type
Partial Recombinant Protein
Gene
ETFDH

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ETFDH Protein

  • electron-transferring-flavoprotein dehydrogenaseEC 1.5.5.1
  • ETFQO
  • ETF-QO
  • MADD
  • mitochondrial

Background

Electron-transferring-flavoprotein dehydrogenase in the inner mitochondrial membrane accepts electrons from electron-transfer flavoprotein which is located in the mitochondrial matrix and reduces ubiquinone in the mitochondrial membrane. The protein is synthesized as a 67-kDa precursor which is targeted to mitochondria and processed in a single step to a 64-kDa mature form located in the mitochondrial membrane. Deficiency in electron-transferring-flavoprotein dehydrogenase have been demonstrated in some patients with type II glutaricacidemia. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55789
Species: Hu
Applications: WB, ICC/IF
NBP1-89545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
MAB2476
Species: Hu
Applications: WB, IHC
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-84856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
NBP1-84312
Species: Hu
Applications: WB, IHC, IHC-P
NB110-41536
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001376-B01P
Species: Hu
Applications: WB
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
AF2727
Species: Hu
Applications: WB, Simple Western, ICC

Publications for ETFDH Partial Recombinant Protein (H00002110-Q01) (0)

There are no publications for ETFDH Partial Recombinant Protein (H00002110-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ETFDH Partial Recombinant Protein (H00002110-Q01) (0)

There are no reviews for ETFDH Partial Recombinant Protein (H00002110-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ETFDH Partial Recombinant Protein (H00002110-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ETFDH Products

Bioinformatics Tool for ETFDH Partial Recombinant Protein (H00002110-Q01)

Discover related pathways, diseases and genes to ETFDH Partial Recombinant Protein (H00002110-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ETFDH Partial Recombinant Protein (H00002110-Q01)

Discover more about diseases related to ETFDH Partial Recombinant Protein (H00002110-Q01).
 

Pathways for ETFDH Partial Recombinant Protein (H00002110-Q01)

View related products by pathway.

PTMs for ETFDH Partial Recombinant Protein (H00002110-Q01)

Learn more about PTMs related to ETFDH Partial Recombinant Protein (H00002110-Q01).

Blogs on ETFDH

There are no specific blogs for ETFDH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ETFDH Antibody
NBP1-83950
FANCD2 Antibody
NB100-182

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ETFDH Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ETFDH