ETFB Recombinant Protein Antigen

Images

 
There are currently no images for ETFB Protein (NBP1-86040PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ETFB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ETFB.

Source: E. coli

Amino Acid Sequence: ETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREID

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ETFB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86040.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ETFB Recombinant Protein Antigen

  • beta-ETF
  • electron transfer flavoprotein beta subunit
  • electron transfer flavoprotein beta-subunit
  • electron transfer flavoprotein subunit beta
  • electron transfer flavoprotein, beta polypeptide
  • electron-transfer-flavoprotein, beta polypeptide
  • electron-transferring-flavoprotein, beta polypeptide
  • MADD

Background

ETFB is a is an electron-transfer-flavoprotein, (beta polypeptide), and a subcomponent of Electron transfer flavoprotein (ETF). ETF exists in the mitochondrial matrix as a heterodimer of 30-kD alpha subunits (ETFA) and 28-kD beta subunits (ETFB) and contains 1 flavin adenine dinucleotide (FAD) and 1 adenosine 5-prime monophosphate (AMP) per heterodimer. This electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases and transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83950
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-84854
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-36953
Species: Hu
Applications: PEP-ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
375-TL
Species: Hu
Applications: BA
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
MAB2476
Species: Hu
Applications: IHC, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP3-26590
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, WB
AF2727
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-24509
Species: Bv, Ca, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
DRT100
Species: Hu
Applications: ELISA
NBP2-33787
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-94053
Species: Hu
Applications: IHC, IHC-P
NBP1-89290
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ETFB Protein (NBP1-86040PEP) (0)

There are no publications for ETFB Protein (NBP1-86040PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ETFB Protein (NBP1-86040PEP) (0)

There are no reviews for ETFB Protein (NBP1-86040PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ETFB Protein (NBP1-86040PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ETFB Products

Research Areas for ETFB Protein (NBP1-86040PEP)

Find related products by research area.

Blogs on ETFB

There are no specific blogs for ETFB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ETFB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ETFB