ERR alpha/NR3B1 Recombinant Protein Antigen

Images

 
There are currently no images for ERR alpha/NR3B1 Recombinant Protein Antigen (NBP2-56812PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ERR alpha/NR3B1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ERR alpha/NR3B1.

Source: E. coli

Amino Acid Sequence: SQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ESRRA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56812.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ERR alpha/NR3B1 Recombinant Protein Antigen

  • ERR alpha
  • ERR1
  • ERR1Estrogen receptor-like 1
  • ERRa
  • ESRL1
  • ESRL1ERR-alpha
  • ESRRA
  • estrogen-related receptor alphaERRalpha
  • NR3B1
  • NR3B1Nuclear receptor subfamily 3 group B member 1
  • steroid hormone receptor ERR1

Background

Estrogen-related receptor alpha (ERR alpha) is an orphan member of the superfamily of nuclear hormone receptors. ERR alpha was initially isolated based on its sequence homology to the estrogen receptor but is not activated by classic estrogens. Binding site selection experiments show that ERR alpha preferentially binds to an ERR alpha response element (ERRE) containing a single consensus half-site, TNAAGGTCA. Data demonstrate that ERR alpha can control the expression of MCAD through the NRRE-1 and thus may play an important role in regulating cellular energy balance in vivo (1). The estrogen-related receptors ERRalpha and ERRbeta (formerly ERR1 and ERR2) form a subgroup of the steroid/thyroid/retinoid receptor family. ERRalpha and ERRbeta are homologous to the estrogen receptor and bind similar DNA targets; however, they are unable to activate gene transcription in response to estrogens (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H6812-00
Species: Hu
Applications: DirELISA, IHC, IP, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-04676
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
NBP3-35470
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NB600-636
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
PP-H6705-00
Species: Hu
Applications: IHC, IP, WB
NBP1-90813
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-89292
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-12264
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP1-89125
Species: Hu, Mu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, KD, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
AF4096
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NB300-541
Species: Am, Av, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB

Publications for ERR alpha/NR3B1 Recombinant Protein Antigen (NBP2-56812PEP) (0)

There are no publications for ERR alpha/NR3B1 Recombinant Protein Antigen (NBP2-56812PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERR alpha/NR3B1 Recombinant Protein Antigen (NBP2-56812PEP) (0)

There are no reviews for ERR alpha/NR3B1 Recombinant Protein Antigen (NBP2-56812PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ERR alpha/NR3B1 Recombinant Protein Antigen (NBP2-56812PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ERR alpha/NR3B1 Products

Research Areas for ERR alpha/NR3B1 Recombinant Protein Antigen (NBP2-56812PEP)

Find related products by research area.

Blogs on ERR alpha/NR3B1

There are no specific blogs for ERR alpha/NR3B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ERR alpha/NR3B1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ESRRA