ERK5/BMK1 Antibody - BSA Free

Immunohistochemistry-Paraffin: ERK5/BMK1 Antibody [NBP3-10647] - Immunohistochemical analysis of formalin-fixed paraffin-embedded human adult liver tissue.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ERK5/BMK1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ERK5/BMK1 Antibody - BSA Free (NBP3-10647) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ERK5/BMK1 (NP_620603). Peptide sequence FDMGVADGPQDGQADSASLSASLLADWLEGHGMNPADIESLQREIQMDSP
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAPK7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 88 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ERK5/BMK1 Antibody - BSA Free

• Big MAP kinase 1
• BMK1 kinase
• BMK1
• BMK-1
• BMK1EC 2.7.11.24
• EC 2.7.11
• ERK5
• ERK-5
• ERK5MAPK 7
• Extracellular signal-regulated kinase 5
• extracellular-signal-regulated kinase 5
• MAP kinase 7
• MAPK7
• mitogen-activated protein kinase 7
• PRKM7ERK4

Background

The extracellular signal-regulated kinase 5 (ERK5), also known as MAPK7 or big mitogen-activated protein kinase 1 (BMK1), is a member of the MAP kinase subfamily (1). ERK5 differs considerably from other MAPKs; it contains an unusually long carboxyl-terminal tail which might contribute to the regulation of its activity and/or localization. In response to extracellular signals, ERK5 translocates to the nucleus, where it regulates gene expression by phosphorylating, and activating different transcription factors (2). ERK5 also differs from other MAPKs in possessing a potent transcriptional activation domain which mediates protein-protein interactions with the myocyte enhancer factor 2 (MEF2) transcription factors (3). ERK5 is specifically activated by MAPK kinase 5 (MAP2K5/MEK5) and plays an important role in mammary epithelial proliferation, endothelial cell survival and normal embryonic development (4-5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAPK7