ERK2 Antibody (1D1)

Images

 
Western Blot: ERK2 Antibody (1D1) [H00005594-M01] - MAPK1 monoclonal antibody (M01), clone 1D1 Analysis of MAPK1 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: ERK2 Antibody (1D1) [H00005594-M01] - Analysis of monoclonal antibody to MAPK1 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: ERK2 Antibody (1D1) [H00005594-M01] - Detection limit for recombinant GST tagged MAPK1 is approximately 0.1ng/ml as a capture antibody.
Proximity Ligation Assay: ERK2 Antibody (1D1) [H00005594-M01] - Analysis of protein-protein interactions between TP53 and MAPK1. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-MAPK1 ...read more
Proximity Ligation Assay: ERK2 Antibody (1D1) [H00005594-M01] - Analysis of protein-protein interactions between MAPK3 and MAPK1. Huh7 cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-MAPK1 ...read more
Sandwich ELISA: ERK2 Antibody (1D1) [H00005594-M01] - Detection limit for recombinant GST tagged MAPK1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, PLA
Clone
1D1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ERK2 Antibody (1D1) Summary

Immunogen
MAPK1 (AAH17832 261 a.a. - 360 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Specificity
MAPK1 - mitogen-activated protein kinase 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAPK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ERK2 Antibody (1D1)

  • EC 2.7.11
  • EC 2.7.11.24
  • ERK
  • ERK2
  • ERK-2
  • ERK2MAP kinase isoform p42
  • ERT1
  • Extracellular signal-regulated kinase 2
  • MAP kinase 1
  • MAP kinase 2
  • MAPK 1
  • MAPK1
  • MAPK2
  • mitogen-activated protein kinase 1
  • Mitogen-activated protein kinase 2
  • p38
  • p40
  • p41
  • p41mapk
  • p42mapk
  • p42-MAPK
  • PRKM1
  • PRKM1MAPK 2
  • PRKM2
  • protein tyrosine kinase ERK2

Background

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-46403
Species: Hu
Applications: IHC
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ERK2 Antibody (H00005594-M01) (0)

There are no publications for ERK2 Antibody (H00005594-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERK2 Antibody (H00005594-M01) (0)

There are no reviews for ERK2 Antibody (H00005594-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ERK2 Antibody (H00005594-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ERK2 Products

Bioinformatics Tool for ERK2 Antibody (H00005594-M01)

Discover related pathways, diseases and genes to ERK2 Antibody (H00005594-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERK2 Antibody (H00005594-M01)

Discover more about diseases related to ERK2 Antibody (H00005594-M01).
 

Pathways for ERK2 Antibody (H00005594-M01)

View related products by pathway.

PTMs for ERK2 Antibody (H00005594-M01)

Learn more about PTMs related to ERK2 Antibody (H00005594-M01).
 

Research Areas for ERK2 Antibody (H00005594-M01)

Find related products by research area.

Blogs on ERK2.

The effects of curcumin on IKB Alpha and the NFkB signaling pathway
The IKK complex, or inhibitor of NFkB kinase, is composed of IKK alpha and IKK beta.  These kinases are at the core of the NFkB signaling cascade.  The NFkB family is made up of transcription factors that are kept inactive in the cytoplasm through...  Read full blog post.

The c-Myc Antibody: A Major Tool in Cancer Research
C-Myc is a widely expressed transcription factor, regulating cellular differentiation, proliferation, cell cycle progression and pro-apoptotic gene expression. The c-Myc antibody is widely used in cancer research, as a number of human tumors have been...  Read full blog post.

Use Of c-Myc Antibodies In Non-Invasive Cancer Studies
Novus Biologicals specializes in offering top quality antibody reagents to many of the transcription factor proteins that are widely expressed in cancer cells.C-Myc is one of several transcription factor proteins covered by our antibody catalog. Enc...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERK2 Antibody (1D1) and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK1
Entrez
OMIM
Uniprot