ERK1 Recombinant Protein Antigen

Images

 
There are currently no images for ERK1 Recombinant Protein Antigen (NBP1-84808PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ERK1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAPK3.

Source: E. coli

Amino Acid Sequence: YVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MAPK3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84808.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ERK1 Recombinant Protein Antigen

  • EC 2.7.11
  • ERK1
  • ERK-1
  • ERK1p44-MAPK
  • ERT2
  • Extracellular signal-regulated kinase 1
  • extracellular signal-related kinase 1
  • HS44KDAP
  • HUMKER1A
  • Insulin-stimulated MAP2 kinase
  • MAP kinase 1
  • MAP kinase 3
  • MAP kinase isoform p44
  • MAPK 1
  • MAPK 3
  • MAPK3
  • MGC20180
  • Microtubule-associated protein 2 kinase
  • Mitogen-activated protein kinase 1
  • mitogen-activated protein kinase 3
  • P44ERK1
  • p44-ERK1
  • p44mapk
  • PRKM3
  • PRKM3EC 2.7.11.24

Background

p44 MAP Kinase (Erk1) is a member of a family of mitogen-activated protein kinases that participate in diverse cellular functions, including the regulation of cell growth and differentiation (1,2). Erk1 regulates meiosis and mitosis by phosphorylating a number of transcription factors such as ELK-1. Activation of Erk1 occurs through phosphorylation of threonine 202 and tyrosine 204 (of human MAP kinase) (3). Erk1 is also known to autophosphorylate on tyrosine (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-47833
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00010598-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-81575
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
236-EG
Species: Hu
Applications: BA
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB

Publications for ERK1 Recombinant Protein Antigen (NBP1-84808PEP) (0)

There are no publications for ERK1 Recombinant Protein Antigen (NBP1-84808PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERK1 Recombinant Protein Antigen (NBP1-84808PEP) (0)

There are no reviews for ERK1 Recombinant Protein Antigen (NBP1-84808PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ERK1 Recombinant Protein Antigen (NBP1-84808PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ERK1 Products

Research Areas for ERK1 Recombinant Protein Antigen (NBP1-84808PEP)

Find related products by research area.

Blogs on ERK1.


  Read full blog post.


  Read full blog post.

The role of c-Fos in the regulation of the JC virus gene transcription
c-Fos is a member of the AP-1 transcription factor family under the Fos protein family umbrella, alongside Fra-1, Fra-2 and Fos-B.  Also in the AP-1 transcription family are the Jun proteins, c-Jun, Jun-B and Jun-D.  Each member of the AP-1 transcri...  Read full blog post.

The effects of curcumin on IKB Alpha and the NFkB signaling pathway
The IKK complex, or inhibitor of NFkB kinase, is composed of IKK alpha and IKK beta.  These kinases are at the core of the NFkB signaling cascade.  The NFkB family is made up of transcription factors that are kept inactive in the cytoplasm through...  Read full blog post.

MAPK3/ERK1 - A signal transduction pathway with roles in development and disease
Mitogen-activated protein kinases (MAPKs) are important signaling proteins needed to transmit and relay extracellular stimuli and to illicit intracellular responses (1). The MAPK family of proteins are serine/threonine kinases that are able to phos...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ERK1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK3