| Immunogen | DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). |
| Specificity | The ERK inhibitory peptide also contains a protein transduction (PTD) sequence (DRQIKIWFQNRRMKWKK) derived from antennapedia which renders the peptide cell permeable. |
| Preparation Method |
Preparation of 5 mM Stock Solutions PBS* is added directly to the vials to prepare the stock solutions. Note: Bring the solution to room temperature and quick spin the tubes before opening the caps. ERK Inhibitor Peptide: 1 mg of DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN Add 53 ul of PBS* to the vial to make a 5 mM stock solution. Mix by vortexing. Aliquot and store at -20C or -80C. Avoid repeated freeze thawing. Control Peptide: 1 mg of DRQIKIWFQNRRMKWKK Add 84.8 ul PBS* to the vial. Mix by vortexing. Aliquot and store at 20C or -80C. Avoid repeated freeze thawing. Recipe for 1X PBS: 1. Dissolve the following in 800ml distilled H2O. -8g of NaCl -0.2g of KCl -1.44g of Na2HPO4 -0.24g of KH2PO4 2. Adjust pH to 7.5 with HCl. 3. Adjust volume to 1L with additional distilled H2O. 4. Sterilize by autoclaving. |
| Content | ERK Inhibitor peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795. |
| Gene | MAPK3 |
| Application Notes | Inhibition of Erk activation. The inhibitor peptide is to block ERK activation by MEK. Optimal peptide concentrations and incubation times vary between model systems and should be determined empirically by users. A 100 uM final concentration may be a useful starting point. Please refer to Kalemen et al (2002) for additional information about how the inhibitor peptide has been used to block ERK activation by MEK. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | Lyophilized white powder |
| Concentration | LYOPH |
| Reconstitution Instructions | Please contact technical support for detailed reconstitution instructions. |
Research Areas for ERK1 Inhibitor (NBP2-31229)Find related products by research area.
|
|
Read full blog post. |
|
Read full blog post. |
|
The role of c-Fos in the regulation of the JC virus gene transcription c-Fos is a member of the AP-1 transcription factor family under the Fos protein family umbrella, alongside Fra-1, Fra-2 and Fos-B. Also in the AP-1 transcription family are the Jun proteins, c-Jun, Jun-B and Jun-D. Each member of the AP-1 transcri... Read full blog post. |
|
The effects of curcumin on IKB Alpha and the NFkB signaling pathway The IKK complex, or inhibitor of NFkB kinase, is composed of IKK alpha and IKK beta. These kinases are at the core of the NFkB signaling cascade. The NFkB family is made up of transcription factors that are kept inactive in the cytoplasm through... Read full blog post. |
|
MAPK3/ERK1 - A signal transduction pathway with roles in development and disease Mitogen-activated protein kinases (MAPKs) are important signaling proteins needed to transmit and relay extracellular stimuli and to illicit intracellular responses (1). The MAPK family of proteins are serine/threonine kinases that are able to phos... Read full blog post. |