ERK1 Inhibitor Peptide Set

Images

 

Product Details

Summary
Product Discontinued
View other related ERK1 Inhibitors

Order Details


    • Catalog Number
      NBP2-31229
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ERK1 Inhibitor Peptide Set Summary

Immunogen
DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN).
Specificity
The ERK inhibitory peptide also contains a protein transduction (PTD) sequence (DRQIKIWFQNRRMKWKK) derived from antennapedia which renders the peptide cell permeable.
Preparation
Method
Preparation of 5 mM Stock Solutions
PBS* is added directly to the vials to prepare the stock solutions. Note: Bring the solution to room temperature and quick spin the tubes before opening the caps.

ERK Inhibitor Peptide: 1 mg of DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN
Add 53 ul of PBS* to the vial to make a 5 mM stock solution. Mix by vortexing. Aliquot and store at -20C or -80C. Avoid repeated freeze thawing.

Control Peptide: 1 mg of DRQIKIWFQNRRMKWKK
Add 84.8 ul PBS* to the vial. Mix by vortexing. Aliquot and store at 20C or -80C. Avoid repeated freeze thawing.
Recipe for 1X PBS:
1. Dissolve the following in 800ml distilled H2O.
-8g of NaCl
-0.2g of KCl
-1.44g of Na2HPO4
-0.24g of KH2PO4
2. Adjust pH to 7.5 with HCl.
3. Adjust volume to 1L with additional distilled H2O.
4. Sterilize by autoclaving.
Content
ERK Inhibitor peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795.
Gene
MAPK3

Applications/Dilutions

Application Notes
Inhibition of Erk activation.
The inhibitor peptide is to block ERK activation by MEK. Optimal peptide concentrations and incubation times vary between model systems and should be determined empirically by users. A 100 uM final concentration may be a useful starting point.

Please refer to Kalemen et al (2002) for additional information about how the inhibitor peptide has been used to block ERK activation by MEK.

Reactivity Notes

Broad; the peptide sequence is 100% conserved among multiple species. Reactivity includes human, mouse, rat, hamster, rabbit, and xenopus.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
Lyophilized white powder
Concentration
LYOPH
Reconstitution Instructions
Please contact technical support for detailed reconstitution instructions.

Notes

Functions as a MEK decoy by binding to ERK.

Alternate Names for ERK1 Inhibitor Peptide Set

  • EC 2.7.11
  • ERK1
  • ERK-1
  • ERK1p44-MAPK
  • ERT2
  • Extracellular signal-regulated kinase 1
  • extracellular signal-related kinase 1
  • HS44KDAP
  • HUMKER1A
  • Insulin-stimulated MAP2 kinase
  • MAP kinase 1
  • MAP kinase 3
  • MAP kinase isoform p44
  • MAPK 1
  • MAPK 3
  • MAPK3
  • MGC20180
  • Microtubule-associated protein 2 kinase
  • Mitogen-activated protein kinase 1
  • mitogen-activated protein kinase 3
  • P44ERK1
  • p44-ERK1
  • p44mapk
  • PRKM3
  • PRKM3EC 2.7.11.24

Background

ERK (extracellular signal-regulated kinase) is a member of the Mitogen-activated protein kinases (MAPK) family of protein kinases that are essential for cellular proliferation and differentiation. The activation of MAPKs requires a cascade mechanism whereby MAPK is phosphorylated by an upstream kinase MAPKK (MEK) which is then, in turn phosphorylated by a third kinase MAPKKK (MEKK). This inhibitory peptide contains the amino-terminal 13 amino acids (GMPKKKPTPIQLN) of MEK1 and binds to ERK.1. This blocks ERK activation by MEK as ERK is unable to interact with MEK.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Inhibitors are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-47833
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00010598-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-81575
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
236-EG
Species: Hu
Applications: BA
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Supplier Logo

Publications for ERK1 Inhibitor (NBP2-31229) (0)

There are no publications for ERK1 Inhibitor (NBP2-31229).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERK1 Inhibitor (NBP2-31229) (0)

There are no reviews for ERK1 Inhibitor (NBP2-31229). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

View specific protocols for ERK1 Inhibitor (NBP2-31229): Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ERK1 Inhibitor (NBP2-31229) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ERK1 Products

Research Areas for ERK1 Inhibitor (NBP2-31229)

Find related products by research area.

Blogs on ERK1.


  Read full blog post.


  Read full blog post.

The role of c-Fos in the regulation of the JC virus gene transcription
c-Fos is a member of the AP-1 transcription factor family under the Fos protein family umbrella, alongside Fra-1, Fra-2 and Fos-B.  Also in the AP-1 transcription family are the Jun proteins, c-Jun, Jun-B and Jun-D.  Each member of the AP-1 transcri...  Read full blog post.

The effects of curcumin on IKB Alpha and the NFkB signaling pathway
The IKK complex, or inhibitor of NFkB kinase, is composed of IKK alpha and IKK beta.  These kinases are at the core of the NFkB signaling cascade.  The NFkB family is made up of transcription factors that are kept inactive in the cytoplasm through...  Read full blog post.

MAPK3/ERK1 - A signal transduction pathway with roles in development and disease
Mitogen-activated protein kinases (MAPKs) are important signaling proteins needed to transmit and relay extracellular stimuli and to illicit intracellular responses (1). The MAPK family of proteins are serine/threonine kinases that are able to phos...  Read full blog post.

Contact Information

Product PDFs

Review this Product

Be the first to review our ERK1 Inhibitor Peptide Set and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK3