ERK1 Antibody (3D6)

Images

 
Western Blot: ERK1 Antibody (3D6) [H00005595-M05] - Analysis of MAPK3 expression in NIH/3T3 (Cat # L018V1).
Immunocytochemistry/ Immunofluorescence: ERK1 Antibody (3D6) [H00005595-M05] - Analysis of monoclonal antibody to MAPK3 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: ERK1 Antibody (3D6) [H00005595-M05] - Analysis of MAPK3 expression in PC-12 (Cat # L012V1).
Western Blot: ERK1 Antibody (3D6) [H00005595-M05] - Analysis of MAPK3 expression in Hela S3 NE (Cat # L013V3).
Western Blot: ERK1 Antibody (3D6) [H00005595-M05] - Analysis of MAPK3 expression in Raw 264.7 (Cat # L024V1).
Western Blot: ERK1 Antibody (3D6) [H00005595-M05] - Analysis of MAPK3 expression in transfected 293T cell line by MAPK3 monoclonal antibody (M05), clone 3D6. Lane 1: MAPK3 transfected lysatE (43.1 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3D6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ERK1 Antibody (3D6) Summary

Immunogen
MAPK3 (AAH13992, 279 a.a. - 379 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP
Specificity
MAPK3 - mitogen-activated protein kinase 3 (3D6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAPK3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ERK1 Antibody (3D6)

  • EC 2.7.11
  • ERK1
  • ERK-1
  • ERK1p44-MAPK
  • ERT2
  • Extracellular signal-regulated kinase 1
  • extracellular signal-related kinase 1
  • HS44KDAP
  • HUMKER1A
  • Insulin-stimulated MAP2 kinase
  • MAP kinase 1
  • MAP kinase 3
  • MAP kinase isoform p44
  • MAPK 1
  • MAPK 3
  • MAPK3
  • MGC20180
  • Microtubule-associated protein 2 kinase
  • Mitogen-activated protein kinase 1
  • mitogen-activated protein kinase 3
  • P44ERK1
  • p44-ERK1
  • p44mapk
  • PRKM3
  • PRKM3EC 2.7.11.24

Background

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. This kinase is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
H00005595-M05
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for ERK1 Antibody (H00005595-M05) (0)

There are no publications for ERK1 Antibody (H00005595-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERK1 Antibody (H00005595-M05) (0)

There are no reviews for ERK1 Antibody (H00005595-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ERK1 Antibody (H00005595-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ERK1 Products

Bioinformatics Tool for ERK1 Antibody (H00005595-M05)

Discover related pathways, diseases and genes to ERK1 Antibody (H00005595-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERK1 Antibody (H00005595-M05)

Discover more about diseases related to ERK1 Antibody (H00005595-M05).
 

Pathways for ERK1 Antibody (H00005595-M05)

View related products by pathway.

PTMs for ERK1 Antibody (H00005595-M05)

Learn more about PTMs related to ERK1 Antibody (H00005595-M05).
 

Research Areas for ERK1 Antibody (H00005595-M05)

Find related products by research area.

Blogs on ERK1.

The role of c-Fos in the regulation of the JC virus gene transcription
c-Fos is a member of the AP-1 transcription factor family under the Fos protein family umbrella, alongside Fra-1, Fra-2 and Fos-B.  Also in the AP-1 transcription family are the Jun proteins, c-Jun, Jun-B and Jun-D.  Each member of the AP-1 transcri...  Read full blog post.

The effects of curcumin on IKB Alpha and the NFkB signaling pathway
The IKK complex, or inhibitor of NFkB kinase, is composed of IKK alpha and IKK beta.  These kinases are at the core of the NFkB signaling cascade.  The NFkB family is made up of transcription factors that are kept inactive in the cytoplasm through...  Read full blog post.

MAPK3/ERK1 - A signal transduction pathway with roles in development and disease
Mitogen-activated protein kinases (MAPKs) are important signaling proteins needed to transmit and relay extracellular stimuli and to illicit intracellular responses (1). The MAPK family of proteins are serine/threonine kinases that are able to phos...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERK1 Antibody (3D6) and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK3
Entrez
Uniprot