ERH Antibody (4A10)

Images

 
Western Blot: ERH Antibody (4A10) [H00002079-M14] - Analysis of ERH expression in transfected 293T cell line by ERH monoclonal antibody (M14), clone 4A10. Lane 1: ERH transfected lysatE (12.3 KDa). Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: ERH Antibody (4A10) [H00002079-M14] - Analysis of monoclonal antibody to ERH on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: ERH Antibody (4A10) [H00002079-M14] - Analysis of monoclonal antibody to ERH on formalin-fixed paraffin-embedded human lung. Antibody concentration 3 ug/ml
ELISA: ERH Antibody (4A10) [H00002079-M14] - Detection limit for recombinant GST tagged ERH is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
4A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ERH Antibody (4A10) Summary

Immunogen
ERH (AAH14301, 1 a.a. - 104 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Specificity
ERH - enhancer of rudimentary homolog (Drosophila)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ERH
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ERH Antibody (4A10)

  • DROER
  • enhancer of rudimentary (Drosophila) homolog
  • enhancer of rudimentary homolog (Drosophila)
  • enhancer of rudimentary homolog
  • FLJ27340

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84297
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92392
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74624
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-84463
Species: Hu
Applications: IHC, IHC-P
NBP1-84466
Species: Hu
Applications: WB, IHC, IHC-P
MAB7957
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00056996-R01
Species: Hu
NB100-757
Species: Hu
Applications: WB, IHC-P
NLS1150
Species: Hu
Applications: IHC-P
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for ERH Antibody (H00002079-M14) (0)

There are no publications for ERH Antibody (H00002079-M14).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERH Antibody (H00002079-M14) (0)

There are no reviews for ERH Antibody (H00002079-M14). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ERH Antibody (H00002079-M14) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ERH Products

Bioinformatics Tool for ERH Antibody (H00002079-M14)

Discover related pathways, diseases and genes to ERH Antibody (H00002079-M14). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERH Antibody (H00002079-M14)

Discover more about diseases related to ERH Antibody (H00002079-M14).
 

Pathways for ERH Antibody (H00002079-M14)

View related products by pathway.

PTMs for ERH Antibody (H00002079-M14)

Learn more about PTMs related to ERH Antibody (H00002079-M14).
 

Research Areas for ERH Antibody (H00002079-M14)

Find related products by research area.

Blogs on ERH

There are no specific blogs for ERH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERH Antibody (4A10) and receive a gift card or discount.

Bioinformatics

Gene Symbol ERH
Entrez
OMIM
Uniprot