eRF1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ETF1. Source: E. coli
Amino Acid Sequence: ILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEF Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
ETF1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38350. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for eRF1 Recombinant Protein Antigen
Background
Termination of protein biosynthesis and release of the nascent polypeptide chain are signaled by the presence of an in-frame stop codon at the aminoacyl site of the ribosome. The process of translation termination is universal and is mediated by protein release factors (RFs) and GTP. A class 1 RF recognizes the stop codon and promotes the hydrolysis of the ester bond linking the polypeptide chain with the peptidyl site tRNA, a reaction catalyzed at the peptidyl transferase center of the ribosome. Class 2 RFs, which are not codon specific and do not recognize codons, stimulate class 1 RF activity and confer GTP dependency upon the process. In prokaryotes, both class 1 RFs, RF1 and RF2, recognize UAA; however, UAG and UGA are decoded specifically by RF1 and RF2, respectively. In eukaryotes, eRF1, or ETF1, the functional counterpart of RF1 and RF2, functions as an omnipotent RF, decoding all 3 stop codons (Frolova et al., 1994 [PubMed 7990965]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Av, Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: CyTOF-ready, Flow, KO
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Dr(-), Hu, Mu(-), Pm, Xp
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IP, MiAr, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Publications for eRF1 Protein (NBP2-38350PEP) (0)
There are no publications for eRF1 Protein (NBP2-38350PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for eRF1 Protein (NBP2-38350PEP) (0)
There are no reviews for eRF1 Protein (NBP2-38350PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for eRF1 Protein (NBP2-38350PEP) (0)
Additional eRF1 Products
Blogs on eRF1