Recombinant Human eRF1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human eRF1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 338-437 of Human eRF1

Source: Wheat Germ

Amino Acid Sequence: TEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDY

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ETF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human eRF1 Protein

  • D5S1995
  • ERF1eRF1
  • eukaryotic peptide chain release factor subunit 1
  • Eukaryotic release factor 1
  • eukaryotic translation termination factor 1
  • polypeptide chain release factor 1
  • Protein Cl1
  • RF1ERF
  • sup45 (yeast omnipotent suppressor 45) homolog-like 1
  • SUP45L1
  • TB3-1MGC111066

Background

Termination of protein biosynthesis and release of the nascent polypeptide chain are signaled by the presence of an in-frame stop codon at the aminoacyl site of the ribosome. The process of translation termination is universal and is mediated by protein release factors (RFs) and GTP. A class 1 RF recognizes the stop codon and promotes the hydrolysis of the ester bond linking the polypeptide chain with the peptidyl site tRNA, a reaction catalyzed at the peptidyl transferase center of the ribosome. Class 2 RFs, which are not codon specific and do not recognize codons, stimulate class 1 RF activity and confer GTP dependency upon the process. In prokaryotes, both class 1 RFs, RF1 and RF2, recognize UAA; however, UAG and UGA are decoded specifically by RF1 and RF2, respectively. In eukaryotes, eRF1, or ETF1, the functional counterpart of RF1 and RF2, functions as an omnipotent RF, decoding all 3 stop codons (Frolova et al., 1994 [PubMed 7990965]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14951
Species: Hu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF7284
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-61418
Species: Hu
Applications: WB
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P, KD
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready, KO
H00005555-P01
Species: Hu
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
H00002107-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for eRF1 Partial Recombinant Protein (H00002107-Q01) (0)

There are no publications for eRF1 Partial Recombinant Protein (H00002107-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eRF1 Partial Recombinant Protein (H00002107-Q01) (0)

There are no reviews for eRF1 Partial Recombinant Protein (H00002107-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for eRF1 Partial Recombinant Protein (H00002107-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for eRF1 Partial Recombinant Protein (H00002107-Q01)

Discover related pathways, diseases and genes to eRF1 Partial Recombinant Protein (H00002107-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eRF1 Partial Recombinant Protein (H00002107-Q01)

Discover more about diseases related to eRF1 Partial Recombinant Protein (H00002107-Q01).
 

Pathways for eRF1 Partial Recombinant Protein (H00002107-Q01)

View related products by pathway.

PTMs for eRF1 Partial Recombinant Protein (H00002107-Q01)

Learn more about PTMs related to eRF1 Partial Recombinant Protein (H00002107-Q01).

Blogs on eRF1

There are no specific blogs for eRF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

eRF1 Antibody
NBP1-31113
c-Fos Antibody
NB110-75039

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human eRF1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ETF1