Recombinant Human eRF1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human eRF1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 338-437 of Human eRF1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDY

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ETF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human eRF1 GST (N-Term) Protein

  • D5S1995
  • ERF1eRF1
  • eukaryotic peptide chain release factor subunit 1
  • Eukaryotic release factor 1
  • eukaryotic translation termination factor 1
  • polypeptide chain release factor 1
  • Protein Cl1
  • RF1ERF
  • sup45 (yeast omnipotent suppressor 45) homolog-like 1
  • SUP45L1
  • TB3-1MGC111066

Background

Termination of protein biosynthesis and release of the nascent polypeptide chain are signaled by the presence of an in-frame stop codon at the aminoacyl site of the ribosome. The process of translation termination is universal and is mediated by protein release factors (RFs) and GTP. A class 1 RF recognizes the stop codon and promotes the hydrolysis of the ester bond linking the polypeptide chain with the peptidyl site tRNA, a reaction catalyzed at the peptidyl transferase center of the ribosome. Class 2 RFs, which are not codon specific and do not recognize codons, stimulate class 1 RF activity and confer GTP dependency upon the process. In prokaryotes, both class 1 RFs, RF1 and RF2, recognize UAA; however, UAG and UGA are decoded specifically by RF1 and RF2, respectively. In eukaryotes, eRF1, or ETF1, the functional counterpart of RF1 and RF2, functions as an omnipotent RF, decoding all 3 stop codons (Frolova et al., 1994 [PubMed 7990965]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45543
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1443
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-04017
Species: Hu
Applications: IP, WB
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-25493
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80306
Species: Av, Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
MAB4614
Species: Hu
Applications: CyTOF-ready, Flow, KO
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-67375
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NB120-6125
Species: Bv, Ca, Dr(-), Hu, Mu(-), Pm, Xp
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IP, MiAr, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB

Publications for eRF1 Partial Recombinant Protein (H00002107-Q01) (0)

There are no publications for eRF1 Partial Recombinant Protein (H00002107-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eRF1 Partial Recombinant Protein (H00002107-Q01) (0)

There are no reviews for eRF1 Partial Recombinant Protein (H00002107-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for eRF1 Partial Recombinant Protein (H00002107-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional eRF1 Products

Blogs on eRF1

There are no specific blogs for eRF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human eRF1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ETF1