eRF1 Antibody [Alexa Fluor® 488]

Images

 

Product Details

Summary
Product Discontinued
View other related eRF1 Primary Antibodies

Order Details


    • Catalog Number
      NBP3-38215AF488
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

eRF1 Antibody [Alexa Fluor® 488] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 278-437 of human eRF1 (NP_004721.1).

Sequence:
VKFIQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ETF1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for eRF1 Antibody [Alexa Fluor® 488]

  • D5S1995
  • ERF1eRF1
  • eukaryotic peptide chain release factor subunit 1
  • Eukaryotic release factor 1
  • eukaryotic translation termination factor 1
  • polypeptide chain release factor 1
  • Protein Cl1
  • RF1ERF
  • sup45 (yeast omnipotent suppressor 45) homolog-like 1
  • SUP45L1
  • TB3-1MGC111066

Background

Termination of protein biosynthesis and release of the nascent polypeptide chain are signaled by the presence of an in-frame stop codon at the aminoacyl site of the ribosome. The process of translation termination is universal and is mediated by protein release factors (RFs) and GTP. A class 1 RF recognizes the stop codon and promotes the hydrolysis of the ester bond linking the polypeptide chain with the peptidyl site tRNA, a reaction catalyzed at the peptidyl transferase center of the ribosome. Class 2 RFs, which are not codon specific and do not recognize codons, stimulate class 1 RF activity and confer GTP dependency upon the process. In prokaryotes, both class 1 RFs, RF1 and RF2, recognize UAA; however, UAG and UGA are decoded specifically by RF1 and RF2, respectively. In eukaryotes, eRF1, or ETF1, the functional counterpart of RF1 and RF2, functions as an omnipotent RF, decoding all 3 stop codons (Frolova et al., 1994 [PubMed 7990965]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45543
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1443
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-04017
Species: Hu
Applications: IP, WB
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-25493
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80306
Species: Av, Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
MAB4614
Species: Hu
Applications: CyTOF-ready, Flow, KO
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB120-6125
Species: Bv, Ca, Dr(-), Hu, Mu(-), Pm, Xp
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IP, MiAr, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB

Publications for eRF1 Antibody (NBP3-38215AF488) (0)

There are no publications for eRF1 Antibody (NBP3-38215AF488).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eRF1 Antibody (NBP3-38215AF488) (0)

There are no reviews for eRF1 Antibody (NBP3-38215AF488). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for eRF1 Antibody (NBP3-38215AF488) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our eRF1 Antibody [Alexa Fluor® 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol ETF1