EPS8L1 Antibody

Images

 
Western Blot: EPS8L1 Antibody [NBP2-32599] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry: EPS8L1 Antibody [NBP2-32599] - Staining of human placenta shows strong positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EPS8L1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GDNVTPRENELWTSLGDSWTRPGLELSPEEGPPYRPEFFSGWEPPVTDPQSRAWEDPVEKQLQHERRRRQQSAPQVAVNGHRDLEPE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EPS8L1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EPS8L1 Protein (NBP2-32599PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EPS8L1 Antibody

  • DRC3EPS8R1
  • epidermal growth factor receptor kinase substrate 8-like protein 1
  • Epidermal growth factor receptor pathway substrate 8-related protein 1
  • EPS8-like 1
  • EPS8-like protein 1
  • EPS8-related protein 1
  • FLJ20258
  • MGC23164
  • MGC4642

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP2-27300
Species: Hu
Applications: WB, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13966
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7008
Species: Hu
Applications: WB, ICC
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-83613
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-50509
Species: Hu
Applications: IHC, IP
AF6260
Species: Hu
Applications: WB
NBP2-31752
Species: Hu
Applications: IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for EPS8L1 Antibody (NBP2-32599) (0)

There are no publications for EPS8L1 Antibody (NBP2-32599).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPS8L1 Antibody (NBP2-32599) (0)

There are no reviews for EPS8L1 Antibody (NBP2-32599). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EPS8L1 Antibody (NBP2-32599) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EPS8L1 Products

Bioinformatics Tool for EPS8L1 Antibody (NBP2-32599)

Discover related pathways, diseases and genes to EPS8L1 Antibody (NBP2-32599). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for EPS8L1 Antibody (NBP2-32599)

View related products by pathway.

PTMs for EPS8L1 Antibody (NBP2-32599)

Learn more about PTMs related to EPS8L1 Antibody (NBP2-32599).

Blogs on EPS8L1

There are no specific blogs for EPS8L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EPS8L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPS8L1