EPLIN Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: EPLIN Antibody [NBP1-87947] - Staining of human cell line U-2 OS shows localization to plasma membrane, cytosol and actin filaments. Antibody staining is shown in green.

Western Blot: EPLIN Antibody [NBP1-87947] - Analysis using Anti-LIMA1 antibody NBP1-87947 (A) shows similar pattern to independent antibody NBP2-38673 (B).

Analysis in human cell lines A-431 and A-549 using Anti-LIMA1 antibody. Corresponding LIMA1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.

Staining of human liver, prostate, rectum and squamous epithelia using Anti-LIMA1 antibody NBP1-87947 (A) shows similar protein distribution across tissues to independent antibody NBP2-38673 (B).

Analysis in human rectum and liver tissues using HPA023871 antibody. Corresponding LIMA1 RNA-seq data are presented for the same tissues.

Staining of human rectum shows strong membranous and cytoplasmic positivity in glandular cells.

Staining of human liver shows very weak membranous positivity in hepatocytes.

Staining of human prostate shows strong membranous positivity in glandular cells.

Staining of human skin shows moderate membranous and cytoplasmic positivity in squamous epithelial cells.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EPLIN Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EPLIN Antibody - BSA Free (NBP1-87947) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-EPLIN Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ISENSYSLDDLEIGPGQLSSSTFDSEKNESRRNLELPRLSETSIKDRMAKYQAAVSKQSSSTNYTNELKASGGEIKIHKMEQKENVPPGPEVCITHQEGEKISANENSLAVRSTPAEDDSRDS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LIMA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 85 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  EPLIN Protein (NBP1-87947PEP)

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 24135282).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EPLIN Antibody - BSA Free

• 1110021C24Rik
• Epithelial protein lost in neoplasm
• EPLINepithelial protein lost in neoplasm beta
• FLJ38853
• LIM domain and actin binding 1
• MGC131726
• SREBP3LIM domain and actin-binding protein 1
• sterol regulatory element binding protein 3

Background

This gene encodes a cytoskeleton-associated protein that inhibits actin filament depolymerization and cross-links filaments in bundles. It is downregulated in some cancer cell lines. Alternatively spliced transcript variants encoding different isoforms have been described for this gene, and expression of some of the variants maybe independently regulated. [provided by RefSeq, Aug 2011]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EPLIN Antibody (NBP1-87947)(5)

Publications using NBP1-87947

• Zhang Z, Lin W, Gan Q et Al. The influences of ApoE isoforms on endothelial adherens junctions and actin cytoskeleton responding to mCRP Angiogenesis 2024-09-14 [PMID: 39276310]
• Esmaeilniakooshkghazi A, Pham E, George SP et al. In colon cancer cells fascin1 regulates adherens junction remodeling FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2023-03-01 [PMID: 36786724] (WB, Human)
• Sano T, Sun X, Feng Y et al. Inhibition of the Growth of Breast Cancer-Associated Brain Tumors by the Osteocyte-Derived Conditioned Medium Cancers 2021-03-03 [PMID: 33802279] (WB, Mouse)
• Steder M, Alla V, Meier C et al. DNp73 Exerts Function in Metastasis Initiation by Disconnecting the Inhibitory Role of EPLIN on IGF1R-AKT/STAT3 Signaling. Cancer Cell. 2013-10-14 [PMID: 24135282] (IHC-P, Mouse)
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: LIMA1
• Entrez:
  • 51474(Human)
• Uniprot:
  • Q9UHB6(Human)