EPLIN Antibody

Images

 
Independent Antibodies: Western Blot: EPLIN Antibody [NBP1-87947] - Analysis using Anti-LIMA1 antibody NBP1-87947 (A) shows similar pattern to independent antibody NBP2-38673 (B).
Immunocytochemistry/ Immunofluorescence: EPLIN Antibody [NBP1-87947] - Staining of human cell line U-2 OS shows localization to plasma membrane, cytosol and actin filaments. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human pancreas using Anti-LIMA1 antibody NBP1-87947.
Orthogonal Strategies: Western Blot: EPLIN Antibody [NBP1-87947] - Analysis in human cell lines A-431 and A-549. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human rectum shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining in human rectum and pancreas tissues using anti-LIMA1 antibody. Corresponding LIMA1 RNA-seq data are presented for the ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human liver, pancreas, rectum and testis using Anti-LIMA1 antibody NBP1-87947 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human testis.
Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human liver.
Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human rectum.
Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human rectum using Anti-LIMA1 antibody NBP1-87947.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EPLIN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ISENSYSLDDLEIGPGQLSSSTFDSEKNESRRNLELPRLSETSIKDRMAKYQAAVSKQSSSTNYTNELKASGGEIKIHKMEQKENVPPGPEVCITHQEGEKISANENSLAVRSTPAEDDSRDS
Specificity
Specificity of human EPLIN antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LIMA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
IHC-P reported in scientific literature (PMID: 24135282). For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
85 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
EPLIN Protein (NBP1-87947PEP)
Publications
Read Publications using
NBP1-87947 in the following applications:

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 24135282).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EPLIN Antibody

  • 1110021C24Rik
  • Epithelial protein lost in neoplasm
  • EPLINepithelial protein lost in neoplasm beta
  • FLJ38853
  • LIM domain and actin binding 1
  • MGC131726
  • SREBP3LIM domain and actin-binding protein 1
  • sterol regulatory element binding protein 3

Background

This gene encodes a cytoskeleton-associated protein that inhibits actin filament depolymerization and cross-links filaments in bundles. It is downregulated in some cancer cell lines. Alternatively spliced transcript variants encoding different isoforms have been described for this gene, and expression of some of the variants maybe independently regulated. [provided by RefSeq, Aug 2011]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94502
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP1-90363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009275-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, S-ELISA
NBP2-72685
Species: Hu
Applications: WB, Flow, ICC/IF, CyTOF-ready
AF497
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
H00001164-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr, Single-Cell Western
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP1-31647
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69368
Species: Hu
Applications: WB, IHC, IHC-P
46610002
Species: Hu
Applications: WB, ELISA
NBP1-87947
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EPLIN Antibody (NBP1-87947)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for EPLIN Antibody (NBP1-87947) (0)

There are no reviews for EPLIN Antibody (NBP1-87947). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EPLIN Antibody (NBP1-87947) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EPLIN Products

Bioinformatics Tool for EPLIN Antibody (NBP1-87947)

Discover related pathways, diseases and genes to EPLIN Antibody (NBP1-87947). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EPLIN Antibody (NBP1-87947)

Discover more about diseases related to EPLIN Antibody (NBP1-87947).
 

Pathways for EPLIN Antibody (NBP1-87947)

View related products by pathway.

PTMs for EPLIN Antibody (NBP1-87947)

Learn more about PTMs related to EPLIN Antibody (NBP1-87947).

Blogs on EPLIN

There are no specific blogs for EPLIN, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EPLIN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LIMA1
Entrez
Uniprot