EPLIN Antibody

Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining in human rectum and pancreas tissues using anti-LIMA1 antibody. Corresponding LIMA1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human liver, pancreas, rectum and testis using Anti-LIMA1 antibody NBP1-87947 (A) shows similar protein distribution across tissues to independent antibody NBP2-38673 (B).

Western Blot: EPLIN Antibody [NBP1-87947] - Analysis in human cell lines A-431 and A-549. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.

Western Blot: EPLIN Antibody [NBP1-87947] - Analysis using Anti-LIMA1 antibody NBP1-87947 (A) shows similar pattern to independent antibody NBP2-38673 (B).

Immunocytochemistry/Immunofluorescence: EPLIN Antibody [NBP1-87947] - Staining of human cell line U-2 OS shows localization to plasma membrane, cytosol and actin filaments. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human rectum shows high expression.

Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human testis.

Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human liver.

Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human pancreas using Anti-LIMA1 antibody NBP1-87947.

Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human rectum using Anti-LIMA1 antibody NBP1-87947.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

EPLIN Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ISENSYSLDDLEIGPGQLSSSTFDSEKNESRRNLELPRLSETSIKDRMAKYQAAVSKQSSSTNYTNELKASGGEIKIHKMEQKENVPPGPEVCITHQEGEKISANENSLAVRSTPAEDDSRDS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LIMA1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC-P reported in scientific literature (PMID: 24135282). For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 85 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  EPLIN Protein (NBP1-87947PEP)

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 24135282).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EPLIN Antibody

• 1110021C24Rik
• Epithelial protein lost in neoplasm
• EPLINepithelial protein lost in neoplasm beta
• FLJ38853
• LIM domain and actin binding 1
• MGC131726
• SREBP3LIM domain and actin-binding protein 1
• sterol regulatory element binding protein 3

Background

This gene encodes a cytoskeleton-associated protein that inhibits actin filament depolymerization and cross-links filaments in bundles. It is downregulated in some cancer cell lines. Alternatively spliced transcript variants encoding different isoforms have been described for this gene, and expression of some of the variants maybe independently regulated. [provided by RefSeq, Aug 2011]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EPLIN Antibody (NBP1-87947)(4)

Publications using NBP1-87947

• Esmaeilniakooshkghazi A, Pham E, George SP et al. In colon cancer cells fascin1 regulates adherens junction remodeling FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2023-03-01 [PMID: 36786724] (WB, Human)
• Sano T, Sun X, Feng Y et al. Inhibition of the Growth of Breast Cancer-Associated Brain Tumors by the Osteocyte-Derived Conditioned Medium Cancers 2021-03-03 [PMID: 33802279] (WB, Mouse)
• Steder M, Alla V, Meier C et al. DNp73 Exerts Function in Metastasis Initiation by Disconnecting the Inhibitory Role of EPLIN on IGF1R-AKT/STAT3 Signaling. Cancer Cell. 2013-10-14 [PMID: 24135282] (IHC-P, Mouse)
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: LIMA1
• Entrez:
  • 51474(Human)
• Uniprot:
  • Q9UHB6(Human)