Epithelial Stromal Interaction 1 Antibody - BSA Free

Western Blot: Epithelial Stromal Interaction 1 Antibody [NBP1-62209] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Epithelial Stromal Interaction 1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to EPSTI1(epithelial stromal interaction 1 (breast)) The peptide sequence was selected form the N terminal of EPSTI1. Peptide sequence RRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPSTI1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Epithelial Stromal Interaction 1 Antibody - BSA Free

• BRESI1
• EC 3.1.4.16
• EC 3.6.3.6
• epithelial stromal interaction 1 (breast)
• epithelial-stromal interaction protein 1
• MGC29634

Background

EPSTI1 was up-regulated in breast carcinomas. The exact function of EPSTI1 is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EPSTI1
• OMIM:
  • NP_001002264(Human)
• Uniprot:
  • Q96J88(Human)