Recombinant Human epithelial Sodium Channel gamma GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human epithelial Sodium Channel gamma GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 101-200 of Human epithelial Sodium Channel gamma

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NINPYKYSTVRHLLADLEQETREALKSLYGFPESRKRREAESWNSVSEGKQPRFSHRIPLLIFDQDEKGKARDFFTGRKRKVGGSIIHKASNVMHIESKQ

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SCNN1G
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human epithelial Sodium Channel gamma GST (N-Term) Protein

  • amiloride-sensitive epithelial sodium channel gamma subunit
  • amiloride-sensitive sodium channel gamma-subunit
  • BESC3
  • ENaC gamma subunit
  • ENaCG
  • ENaCgamma
  • Epithelial Na(+) channel subunit gamma
  • gamma-ENaC
  • gamma-NaCH
  • Nonvoltage-gated sodium channel 1 subunit gamma
  • PHA1
  • SCNEGamiloride-sensitive sodium channel subunit gamma
  • sodium channel, nonvoltage-gated 1, gamma

Background

Nonvoltage-gated, amiloride-sensitive, sodium channels control fluid and electrolyte transport across epithelia in many organs. These channels are heteromeric complexes consisting of 3 subunits: alpha, beta, and gamma. This gene encodes the gamma subunit, and mutations in this gene have been associated with Liddle syndrome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-18257
Species: Ha, Hu, Mu, Rt, Xp
Applications: IHC, WB
NB100-74357
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-44270
Species: Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-P, WB
MAB25031
Species: Hu
Applications: IHC, IP, WB
NB300-562
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-80993
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00006446-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NB110-74682
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB110-81529
Species: Hu, Mu, Ma-Op, Po, Pm, Rb, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IP, KD, KO, Simple Western, WB
H00051802-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-82874
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
H00023327-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-62346
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
H00006340-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for epithelial Sodium Channel gamma Partial Recombinant Protein (H00006340-Q01) (0)

There are no publications for epithelial Sodium Channel gamma Partial Recombinant Protein (H00006340-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for epithelial Sodium Channel gamma Partial Recombinant Protein (H00006340-Q01) (0)

There are no reviews for epithelial Sodium Channel gamma Partial Recombinant Protein (H00006340-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for epithelial Sodium Channel gamma Partial Recombinant Protein (H00006340-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional epithelial Sodium Channel gamma Products

Bioinformatics Tool for epithelial Sodium Channel gamma Partial Recombinant Protein (H00006340-Q01)

Discover related pathways, diseases and genes to epithelial Sodium Channel gamma Partial Recombinant Protein (H00006340-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for epithelial Sodium Channel gamma Partial Recombinant Protein (H00006340-Q01)

Discover more about diseases related to epithelial Sodium Channel gamma Partial Recombinant Protein (H00006340-Q01).
 

Pathways for epithelial Sodium Channel gamma Partial Recombinant Protein (H00006340-Q01)

View related products by pathway.

PTMs for epithelial Sodium Channel gamma Partial Recombinant Protein (H00006340-Q01)

Learn more about PTMs related to epithelial Sodium Channel gamma Partial Recombinant Protein (H00006340-Q01).

Blogs on epithelial Sodium Channel gamma

There are no specific blogs for epithelial Sodium Channel gamma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human epithelial Sodium Channel gamma GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SCNN1G