We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human epithelial Sodium Channel beta GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Endotoxin, AP

Order Details

Recombinant Human epithelial Sodium Channel beta GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-640 of Human SCNN1B

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRTICEGPKKKAMWFLLTLLFAALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SCNN1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
96.14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human epithelial Sodium Channel beta GST (N-Term) Protein

  • amiloride-sensitive sodium channel subunit beta 1
  • amiloride-sensitive sodium channel subunit beta
  • BESC1
  • Beta-ENaC
  • Beta-NaCH
  • ENaCB
  • ENaCbeta
  • Epithelial Na(+) channel subunit beta
  • epithelial Sodium Channel beta
  • epithelial sodium channel beta-2 subunit
  • epithelial sodium channel beta-3 subunit
  • nasal epithelial sodium channel beta subunit
  • Nonvoltage-gated sodium channel 1 subunit beta
  • SCNEB
  • SCNN1B
  • sodium channel, nonvoltage-gated 1, beta

Background

SCNN1B( AAH36352, 1 a.a. - 641 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-18256
Species: Ha, Hu, Mu, Rt, Xp
Applications: IHC, WB
NB100-74357
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-44270
Species: Ca, Hu, Mu, Rt
Applications: EM, ICC/IF, IHC,  IHC-P, WB
NBP1-80993
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF4277
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NB300-562
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-83258
Species: Hu
Applications: IHC,  IHC-P
NBP1-82574
Species: Hu
Applications: IHC,  IHC-P
H00023327-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF3200
Species: Hu
Applications: IHC, WB
MAB6218
Species: Hu, Mu, Rt
Applications: WB
NBP1-85004
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
236-EG
Species: Hu
Applications: BA
MAB8630
Species: Hu
Applications: IHC, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB

Publications for epithelial Sodium Channel beta Recombinant Protein (H00006338-P01) (0)

There are no publications for epithelial Sodium Channel beta Recombinant Protein (H00006338-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for epithelial Sodium Channel beta Recombinant Protein (H00006338-P01) (0)

There are no reviews for epithelial Sodium Channel beta Recombinant Protein (H00006338-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for epithelial Sodium Channel beta Recombinant Protein (H00006338-P01). (Showing 1 - 1 of 1 FAQ).

  1. Why are there 2 additional bands on the photo for product H00006338-P01?
    • The epithelial Sodium Channel beta Recombinant Protein (H00006338-P01) is a product we distribute for a Taiwanese company called Abnova. We do not perform any in-house testing or development of their products. The image that appears on our website is taken from their datasheet showing a 12.5% SDS-PAGE stained with Coomassie Blue. We unfortunately do not have any information regarding the two additional bands seen in the gel. Abnova's recombinant proteins are produced in a cell-free wheat germ system. This protein was made to the full length sequence of human Amiloride-sensitive sodium channel subunit beta (Acc# P51168). The protein also contains a GST tag. See the following link for a description of their production process: http://www.abnova.com/support/Protein.asp

Additional epithelial Sodium Channel beta Products

Research Areas for epithelial Sodium Channel beta Recombinant Protein (H00006338-P01)

Find related products by research area.

Blogs on epithelial Sodium Channel beta

There are no specific blogs for epithelial Sodium Channel beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human epithelial Sodium Channel beta GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SCNN1B