Recombinant Human epithelial Sodium Channel beta GST (N-Term) Protein Summary
| Description |
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-640 of Human SCNN1B Source: Wheat Germ (in vitro) Amino Acid Sequence: MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRTICEGPKKKAMWFLLTLLFAALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI |
Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
SCNN1B |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
| Theoretical MW |
96.14 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human epithelial Sodium Channel beta GST (N-Term) Protein
Background
SCNN1B( AAH36352, 1 a.a. - 641 a.a.) recombinant protein with GST.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ha, Hu, Mu, Rt, Xp
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IP, WB
Species: Ca, Hu, Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, Neut, WB
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PAGE, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Publications for epithelial Sodium Channel beta Recombinant Protein (H00006338-P01) (0)
There are no publications for epithelial Sodium Channel beta Recombinant Protein (H00006338-P01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for epithelial Sodium Channel beta Recombinant Protein (H00006338-P01) (0)
There are no reviews for epithelial Sodium Channel beta Recombinant Protein (H00006338-P01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for epithelial Sodium Channel beta Recombinant Protein (H00006338-P01). (Showing 1 - 1 of 1 FAQ).
-
Why are there 2 additional bands on the photo for product H00006338-P01?
- The epithelial Sodium Channel beta Recombinant Protein (H00006338-P01) is a product we distribute for a Taiwanese company called Abnova. We do not perform any in-house testing or development of their products. The image that appears on our website is taken from their datasheet showing a 12.5% SDS-PAGE stained with Coomassie Blue. We unfortunately do not have any information regarding the two additional bands seen in the gel. Abnova's recombinant proteins are produced in a cell-free wheat germ system. This protein was made to the full length sequence of human Amiloride-sensitive sodium channel subunit beta (Acc# P51168). The protein also contains a GST tag. See the following link for a description of their production process: http://www.abnova.com/support/Protein.asp
Additional epithelial Sodium Channel beta Products
Research Areas for epithelial Sodium Channel beta Recombinant Protein (H00006338-P01)
Find related products by research area.
|
Blogs on epithelial Sodium Channel beta