epithelial Sodium Channel beta Antibody

Images

 
Western Blot: epithelial Sodium Channel beta Antibody [H00006338-B01P] - Analysis of SCNN1B expression in transfected 293T cell line by SCNN1B polyclonal antibody. Lane 1: SCNN1B transfected lysate(72.60 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

epithelial Sodium Channel beta Antibody Summary

Immunogen
SCNN1B (AAH36352.2, 1 a.a. - 640 a.a.) full-length human protein. MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRTICEGPKKKAMWFLLTLLFAALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI
Specificity
Reacts with sodium channel, nonvoltage-gated 1, beta.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SCNN1B
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for epithelial Sodium Channel beta Antibody

  • amiloride-sensitive sodium channel subunit beta 1
  • amiloride-sensitive sodium channel subunit beta
  • BESC1
  • beta-ENaC
  • beta-NaCH
  • ENaCb
  • ENaCbeta
  • Epithelial Na(+) channel subunit beta
  • epithelial sodium channel beta-2 subunit
  • epithelial sodium channel beta-3 subunit
  • nasal epithelial sodium channel beta subunit
  • Nonvoltage-gated sodium channel 1 subunit beta
  • SCNEB
  • sodium channel, nonvoltage-gated 1, beta

Background

Nonvoltage-gated, amiloride-sensitive, sodium channels control fluid and electrolyte transport across epithelia in many organs. These channels are heteromeric complexes consisting of 3 subunits: alpha, beta, and gamma. This gene encodes the beta subunit, and mutations in this gene have been associated with pseudohypoaldosteronism type 1 (PHA1), and Liddle syndrome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41371
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, S-ELISA, ELISA(Cap)
NB100-74357
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-86376
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57622
Species: Hu
Applications: WB, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
NBP1-83258
Species: Hu
Applications: IHC, IHC-P
NB110-81529
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
NBP1-54974
Species: Hu
Applications: WB
NBP2-19010
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27201
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB
NBP1-85004
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00006338-B01P
Species: Hu
Applications: WB

Publications for epithelial Sodium Channel beta Antibody (H00006338-B01P) (0)

There are no publications for epithelial Sodium Channel beta Antibody (H00006338-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for epithelial Sodium Channel beta Antibody (H00006338-B01P) (0)

There are no reviews for epithelial Sodium Channel beta Antibody (H00006338-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for epithelial Sodium Channel beta Antibody (H00006338-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional epithelial Sodium Channel beta Products

Bioinformatics Tool for epithelial Sodium Channel beta Antibody (H00006338-B01P)

Discover related pathways, diseases and genes to epithelial Sodium Channel beta Antibody (H00006338-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for epithelial Sodium Channel beta Antibody (H00006338-B01P)

Discover more about diseases related to epithelial Sodium Channel beta Antibody (H00006338-B01P).
 

Pathways for epithelial Sodium Channel beta Antibody (H00006338-B01P)

View related products by pathway.

PTMs for epithelial Sodium Channel beta Antibody (H00006338-B01P)

Learn more about PTMs related to epithelial Sodium Channel beta Antibody (H00006338-B01P).

Blogs on epithelial Sodium Channel beta

There are no specific blogs for epithelial Sodium Channel beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our epithelial Sodium Channel beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCNN1B
Entrez
Uniprot