Ephrin-A3 Antibody

Images

 
Western Blot: Ephrin-A3 Antibody [H00001944-B01P] - Analysis of EFNA3 expression in transfected 293T cell line by EFNA3 polyclonal antibody. Lane 1: EFNA3 transfected lysate(26.40 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: Ephrin-A3 Antibody [H00001944-B01P] - Analysis of purified antibody to EFNA3 on 293 cell. (antibody concentration 1 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Ephrin-A3 Antibody Summary

Immunogen
EFNA3 (NP_004943.1, 1 a.a. - 238 a.a.) full-length human protein. MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
Specificity
Reacts with ephrin-A3.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
EFNA3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
This antibody is useful for IF and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ephrin-A3 Antibody

  • EFL2
  • EFL-2
  • EFNA3
  • Ehk1-L
  • EPH-related receptor tyrosine kinase ligand 3
  • EphrinA3
  • Ephrin-A3
  • EPLG3EHK1 ligand
  • LERK3
  • LERK3LERK-3
  • ligand of eph-related kinase 3

Background

This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

374-EA
Species: Hu
AF603
Species: Mu
Applications: WB, Block, ICC
AF3034
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF369
Species: Hu
Applications: WB, IHC, ICC
MAB541
Species: Hu, Rt
Applications: WB, Flow, CyTOF-ready, ICC
AF641
Species: Mu
Applications: WB, IHC
640-A3
Species: Mu
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13964
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF454
Species: Mu
Applications: WB
MAB3035
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-88930
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for Ephrin-A3 Antibody (H00001944-B01P) (0)

There are no publications for Ephrin-A3 Antibody (H00001944-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ephrin-A3 Antibody (H00001944-B01P) (0)

There are no reviews for Ephrin-A3 Antibody (H00001944-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ephrin-A3 Antibody (H00001944-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ephrin-A3 Products

Bioinformatics Tool for Ephrin-A3 Antibody (H00001944-B01P)

Discover related pathways, diseases and genes to Ephrin-A3 Antibody (H00001944-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ephrin-A3 Antibody (H00001944-B01P)

Discover more about diseases related to Ephrin-A3 Antibody (H00001944-B01P).
 

Pathways for Ephrin-A3 Antibody (H00001944-B01P)

View related products by pathway.

PTMs for Ephrin-A3 Antibody (H00001944-B01P)

Learn more about PTMs related to Ephrin-A3 Antibody (H00001944-B01P).
 

Research Areas for Ephrin-A3 Antibody (H00001944-B01P)

Find related products by research area.

Blogs on Ephrin-A3

There are no specific blogs for Ephrin-A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ephrin-A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EFNA3
Entrez
Uniprot