Ephrin-A1 Recombinant Protein Antigen

Images

 
There are currently no images for Ephrin-A1 Recombinant Protein Antigen (NBP2-76497PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Ephrin-A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Ephrin-A1.

Source: E. coli

Amino Acid Sequence: RHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EFNA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-76497.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Ephrin-A1 Recombinant Protein Antigen

  • B61
  • ECKLG
  • EFL1
  • EFL-1
  • EFNA1
  • EPH-related receptor tyrosine kinase ligand 1
  • EphrinA1
  • Ephrin-A1
  • EPLG1TNF alpha-induced protein 4
  • Immediate early response protein B61
  • LERK1
  • LERK1LERK-1
  • ligand of eph-related kinase 1
  • TNFAIP4B61
  • Tumor necrosis factor alpha-induced protein 4
  • tumor necrosis factor, alpha-induced protein 4

Background

The Eph subfamily represents the largest group of receptor protein kinases identified to date. There is increasing evidence that Eph family members are involved in central nervous system function and in development. Ligands for Eph receptors include ephrin-A1 (LERK-1/B61), identified as a ligand for the EphA2 (Eck) receptor; ephrin-A2 (ELF-1), identified as a ligand for the EphA3 and EphA4 (Sek) receptors; ephrin-A3 (LERK-3), identified as a ligand for EphA5 (Ehk1) and EphA3 (Hek) receptors; ephrin-A4 (LERK-4), identified as a ligand for the EphA3 receptor; ephrin-A5 (AL-1), identified as a ligand for EphA5 (REK7); ephrin-B1 (LERK-2), identified as a ligand for the EphB1 (Elk) and EphB2 (Cek5) receptors; ephrin-B2 (LERK-5), identified as a ligand for the EphB1, EphB3 (Cek10) and EphB2 receptors; and ephrin-B3 (LERK-8), identified as a ligand for EphB1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3035
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, WB
AF638
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
AF473
Species: Mu
Applications: IHC, Simple Western, WB
8415-A2
Species: Mu
Applications: BA
359-EA
Species: Hu
Applications: Bind
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF641
Species: Mu
Applications: IHC, WB
DVE00
Species: Hu
Applications: ELISA
AF496
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP1-59069
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF4467
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
374-EA
Species: Hu
Applications: Bind
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-76497PEP
Species: Hu
Applications: AC

Publications for Ephrin-A1 Recombinant Protein Antigen (NBP2-76497PEP) (0)

There are no publications for Ephrin-A1 Recombinant Protein Antigen (NBP2-76497PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ephrin-A1 Recombinant Protein Antigen (NBP2-76497PEP) (0)

There are no reviews for Ephrin-A1 Recombinant Protein Antigen (NBP2-76497PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Ephrin-A1 Recombinant Protein Antigen (NBP2-76497PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ephrin-A1 Products

Research Areas for Ephrin-A1 Recombinant Protein Antigen (NBP2-76497PEP)

Find related products by research area.

Blogs on Ephrin-A1

There are no specific blogs for Ephrin-A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Ephrin-A1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EFNA1