EphB1 Antibody

Immunohistochemistry-Paraffin: EphB1 Antibody [NBP2-55594] - Staining in human testis and pancreas tissues using anti-EPHB1 antibody. Corresponding EPHB1 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: EphB1 Antibody [NBP2-55594] - Staining of human cell line BJ shows localization to plasma membrane, cytosol & endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: EphB1 Antibody [NBP2-55594] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: EphB1 Antibody [NBP2-55594] - Staining of human testis shows high expression.

Product Discontinued

EphB1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNE
• Predicted Species: Mouse (99%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPHB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EphB1 Antibody

• Cek6
• EC 2.7.10
• EC 2.7.10.1
• EK6
• Elk
• EPH receptor B1
• eph tyrosine kinase 2
• EphB1
• EPH-like kinase 6
• ephrin type-B receptor 1
• EPHT2FLJ37986
• Hek6
• Net
• NETHek6
• soluble EPHB1 variant 1
• Tyrosine-protein kinase receptor EPH-2

Background

EphrinB proteins are thought to play key roles in cellular functions as diverse as neuronal migration and blood vessel development. EphrinB molecules expressed at the membrane surface bind to the EphB family receptors on target cells during cell-to cell contact. This interaction leads to cell signaling in the target cell but also generates a reverse signal in the cell expressing EphrinB on its surface. This reverse signaling event is thought to be critical for vessel maturation and neuronal development. Importantly, tyrosine phosphorylation of EphrinB is thought to be a critical component of this reverse signaling event. Recent work suggests that phosphorylation of a specific EphrinB residue (Tyr298) plays a key role in EphrinB signaling. (3, 5)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EPHB1