EPB41L5 Antibody

Images

 
Western Blot: EPB41L5 Antibody [NBP2-30920] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: EPB41L5 Antibody [NBP2-30920] - Staining of human cell line A-431 shows positivity in plasma membrane. Antibody staining is shown in green.
Immunohistochemistry: EPB41L5 Antibody [NBP2-30920] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EPB41L5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LLASLTENLIDHTVAPQVSSTSMITPRWIVPQSGAMSNGLAGCEMLLTGKEGHGNKDGISLISPPAPFLVDAVTS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EPB41L5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EPB41L5 Protein (NBP2-30920PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EPB41L5 Antibody

  • band 4.1-like protein 5
  • erythrocyte membrane protein band 4.1 like 5
  • FLJ12957
  • KIAA1548BE37
  • YMO1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83988
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31650
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85007
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00051168-Q01
Species: Hu
NBP1-84266
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-82289
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF7979
Species: Hu, Mu, Rt
Applications: WB
AF7548
Species: Hu
Applications: IHC
NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-61027
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, Simple Western
NBP2-56113
Species: Hu
Applications: IHC-P
H00002035-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-90325
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-84725
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EPB41L5 Antibody (NBP2-30920) (0)

There are no publications for EPB41L5 Antibody (NBP2-30920).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPB41L5 Antibody (NBP2-30920) (0)

There are no reviews for EPB41L5 Antibody (NBP2-30920). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EPB41L5 Antibody (NBP2-30920) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EPB41L5 Products

Bioinformatics Tool for EPB41L5 Antibody (NBP2-30920)

Discover related pathways, diseases and genes to EPB41L5 Antibody (NBP2-30920). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EPB41L5 Antibody (NBP2-30920)

Discover more about diseases related to EPB41L5 Antibody (NBP2-30920).
 

Pathways for EPB41L5 Antibody (NBP2-30920)

View related products by pathway.

PTMs for EPB41L5 Antibody (NBP2-30920)

Learn more about PTMs related to EPB41L5 Antibody (NBP2-30920).

Blogs on EPB41L5

There are no specific blogs for EPB41L5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EPB41L5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPB41L5
Uniprot