EPB41L4A Antibody - BSA Free

Immunohistochemistry-Paraffin: EPB41L4A Antibody [NBP1-81009] - Staining of human thyroid gland shows moderate nuclear and cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EPB41L4A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EPB41L4A Antibody - BSA Free (NBP1-81009) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SNSLSRKLSKFGSIRYKHRYSGRTALQMSRDLSIQLPRPDQNVTRSRSKTYPKRIAQTQPAESNSISRITANMENGENEGTIK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPB41L4A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  EPB41L4A Protein (NBP1-81009PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EPB41L4A Antibody - BSA Free

• DKFZp566L203
• EPB41L4erythrocyte protein band 4.1-like 4
• erythrocyte membrane protein band 4.1 like 4A
• FLJ38738
• NBL4band 4.1-like protein 4A
• Protein NBL4

Background

EPB41L4A, also known as Erythrocyte membrane protein band 4.1 like 4A, is an approximately 79 kDA 686 amino acid protein, which is currently thought to be connected with cytoskeletal to plasma membrane regulation, and is commonly found highly expressed in brain, liver, and thymus. Studies are currently being performed on the relationship of this EPB41L4A protein to melanomas and teratocarcinoma. This protein is regulated by uranyl nitrate, GnRH-A and Hmga1, and is involved in actin calmodulin and cytoskeletal protein binding.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EPB41L4A
• Entrez:
  • 64097(Human)