EPB41L4A Antibody

Images

 
Immunohistochemistry-Paraffin: EPB41L4A Antibody [NBP1-81009] - Staining of human thyroid gland shows moderate nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EPB41L4A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SNSLSRKLSKFGSIRYKHRYSGRTALQMSRDLSIQLPRPDQNVTRSRSKTYPKRIAQTQPAESNSISRITANMENGENEGTIK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EPB41L4A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EPB41L4A Protein (NBP1-81009PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EPB41L4A Antibody

  • DKFZp566L203
  • EPB41L4erythrocyte protein band 4.1-like 4
  • erythrocyte membrane protein band 4.1 like 4A
  • FLJ38738
  • NBL4band 4.1-like protein 4A
  • Protein NBL4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002035-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-31572
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33879
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34685
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-67584
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-52977
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-00181
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP1-06034
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-93945
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80867
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-94064
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC, KO
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EPB41L4A Antibody (NBP1-81009) (0)

There are no publications for EPB41L4A Antibody (NBP1-81009).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPB41L4A Antibody (NBP1-81009) (0)

There are no reviews for EPB41L4A Antibody (NBP1-81009). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EPB41L4A Antibody (NBP1-81009) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EPB41L4A Products

Bioinformatics Tool for EPB41L4A Antibody (NBP1-81009)

Discover related pathways, diseases and genes to EPB41L4A Antibody (NBP1-81009). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for EPB41L4A Antibody (NBP1-81009)

View related products by pathway.

Blogs on EPB41L4A

There are no specific blogs for EPB41L4A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EPB41L4A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPB41L4A
Entrez