EPB41 Recombinant Protein Antigen

Images

 
There are currently no images for EPB41 Recombinant Protein Antigen (NBP3-17707PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

EPB41 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EPB41

Source: E. coli

Amino Acid Sequence: EEGKEVESDKEKGEGGQKEIEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEELREDPDFEIKEGEGLEECSKIEVKEESPQSKAETELK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EPB41
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17707.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EPB41 Recombinant Protein Antigen

  • 4.1RBand 4.1
  • E41P
  • EL1
  • EPB4.1
  • erythrocyte membrane protein band 4.1 (elliptocytosis 1, RH-linked)
  • erythrocyte surface protein band 4.1
  • HE
  • P4.1
  • protein 4.1

Background

Elliptocytosis is a hematologic disorder characterized by elliptically shaped erythrocytes and a variable degree of hemolytic anemia. Inherited as an autosomal dominant, elliptocytosis results from mutation in any one of several genes encoding proteins of the red cell membrane skeleton. The form discussed here is the one found in the 1950s to be linked to Rh blood group and more recently shown to be caused by a defect in protein 4.1. 'Rh-unlinked' forms of elliptocytosis are caused by mutation in the alpha-spectrin gene (MIM 182860), the beta-spectrin gene (MIM 182870), or the band 3 gene (MIM 109270).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31572
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-61027
Species: Hu, Mu, Pm, Rt, Xp
Applications: Simple Western, WB
NBP2-16396
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC,  IHC-P, WB
NBP3-15385
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-06034
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA
NBP2-32875
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
H00005962-M06
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
H00004354-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB7745
Species: Hu
Applications: IHC, KO, Simple Western, WB
NBP2-94064
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
DRT100
Species: Hu
Applications: ELISA
NB300-517
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, KD, WB
MAB6638
Species: Hu, Mu, Rt
Applications: WB
DR2A00
Species: Hu
Applications: ELISA
NBP3-17707PEP
Species: Hu
Applications: AC

Publications for EPB41 Recombinant Protein Antigen (NBP3-17707PEP) (0)

There are no publications for EPB41 Recombinant Protein Antigen (NBP3-17707PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPB41 Recombinant Protein Antigen (NBP3-17707PEP) (0)

There are no reviews for EPB41 Recombinant Protein Antigen (NBP3-17707PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EPB41 Recombinant Protein Antigen (NBP3-17707PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EPB41 Products

Array NBP3-17707PEP

Blogs on EPB41

There are no specific blogs for EPB41, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EPB41 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EPB41