Epac2 Antibody - BSA Free

Western Blot: Epac2 Antibody [NBP2-87366] - Host: Rabbit. Target Name: RPGF4. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Epac2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human Epac2. Peptide sequence: LEKIVKQISEDAKAPQKKHKVLLQQFNTGDERAQKRQPIRGSDEVLFKVY The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAPGEF4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Epac2 Antibody - BSA Free

• cAMP-GEFII
• cAMP-regulated guanine nucleotide exchange factor II
• CGEF2
• CGEF2EPAC 2
• EPAC 2
• Epac2
• Exchange factor directly activated by cAMP 2
• Exchange protein directly activated by cAMP 2
• Nbla00496
• putative protein product of Nbla00496
• Rap guanine nucleotide exchange factor (GEF) 4
• rap guanine nucleotide exchange factor 4
• RAP guanine-nucleotide-exchange factor (GEF) 4
• RAPGEF4

Background

Epac2, also known as Rap Guanine Nucleotide Exchange Factor (GEF) 4, is a guanine nucleotide exchange factor for RAP1A, RAP1B and RAP2A small GTPases. Studies have shown that EPAC2 has a significant role in the development of type 2 diabetes. EPAC2 has also been studied in relation to ataxia, neuronitis, osteoporosis and pancreatitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAPGEF4